KEGG   Pseudomonas aeruginosa c7447m: M802_4793Help
Entry
M802_4793         CDS       T03098                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
paec  Pseudomonas aeruginosa c7447m
Pathway
paec00020  Citrate cycle (TCA cycle)
paec00620  Pyruvate metabolism
paec01100  Metabolic pathways
paec01110  Biosynthesis of secondary metabolites
paec01120  Microbial metabolism in diverse environments
paec01130  Biosynthesis of antibiotics
paec01200  Carbon metabolism
Module
paec_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paec_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M802_4793 (mqo)
   00620 Pyruvate metabolism
    M802_4793 (mqo)
Enzymes [BR:paec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     M802_4793 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Amino_oxidase FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGV64368
Position
5206266..5207789
Genome map
AA seq 507 aa AA seqDB search
MAQNDHETVDMLLVGAGIMSATLAVLLKELDPNLKMEVVELQESGAIESSNPWNNAGTGH
AGLCELNYTPQSADGSIDIKKAVGINTMFEVSKQFWSHLVAKGTFGSPKTFINPVPHLSF
VRGSEGIAYLKKRFESLTKHHAFETMVYSEDKATLAEWMPLMMPGRPADEAIAATRVEGG
TDVNFGALTNQLLQHLAQQPGAQIRYNQKVTHLRRADNGWRVTVKDTRNGGDREIQARFV
FLGAGGGALPLLQLSGIPEGKGFGGFPVSGQWLRCDNPEIVKQHQAKVYSQAEVGSPPMS
VPHLDTRVVDGKKSLLFGPYAGFSTKFLRHGSFLDLPLSVRPGNILPMLSVARDNMDLTR
YLIGQVMQSPEQRLEALRKFYPEARAEDWRLEVAGQRVQIIKKDPKKGGILQFGTELVAA
HDGSIAALLGASPGASVTVSIMLGLIERCFPEQARSPEWSAKLKEIFPAREKELESDAEL
YRSVSSRCSEVLELTAKNDVQAPVNAE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaacgatcacgaaacagtcgacatgctgctggtaggcgccggcatcatgagc
gcgaccctggcggtcctgctcaaggaactcgaccccaacctgaagatggaagtcgtcgaa
ctccaggagtccggcgcgatcgaaagctccaacccgtggaacaacgcgggcaccggccac
gccggcctgtgcgagctgaactacaccccgcagtcggccgacggcagcatcgacatcaag
aaagccgtgggcatcaacaccatgttcgaggtgtcgaagcagttctggtcgcacctggtc
gccaagggcaccttcggctcgccgaagaccttcatcaacccggtaccgcacctgagcttc
gtgcgcggcagtgaaggcatcgcctacctgaagaagcgcttcgaatcgctgacgaagcac
cacgctttcgagaccatggtctactccgaggacaaggccaccctcgccgagtggatgccg
ctgatgatgccgggtcgtccggccgacgaagcgatcgccgcgacccgcgtcgagggcggt
accgacgtcaacttcggcgccctgaccaaccagctcctgcaacacctggcgcaacagccg
ggcgcgcagatccgctacaaccagaaggtcacccacctgcgccgcgccgataacggctgg
cgggtcaccgtcaaggacacccgcaacggcggcgaccgcgagatccaggcacgcttcgtc
ttcctcggcgccggcggcggcgccctgccgctcctgcaactttccggcatcccggaaggc
aagggcttcggtggtttcccggtgagcggccagtggctgcgctgcgacaacccggaaatc
gtcaagcagcaccaggccaaggtctacagccaggccgaggtcggctcgccgccgatgtcc
gtgccgcacctggacacccgcgtggtggacggcaagaaatccctgctgttcggcccctat
gccggtttctccaccaagttcctgcgccatggctcgttcctcgacctgccgctgtcggta
cgcccgggcaacatcctgccgatgctctcggtggcccgcgacaacatggacctgacccgc
tacctgatcggccaggtcatgcagtcgccggaacagcgcctggaagccctgcgcaagttc
taccccgaagccagggccgaggactggcgcctggaagtcgccggccagcgcgtgcagatc
atcaagaaggatccgaagaaaggcggcatcctgcagttcggcaccgagctggtggccgcc
cacgacggctccatcgccgccctgctgggcgcctcgccgggcgcctcggtgaccgtctcg
atcatgctcggcctgatcgagcgctgcttcccggagcaggcccgctcgccggagtggagc
gccaagctgaaggaaatcttcccggctcgcgagaaagagctggaaagcgacgccgagctg
taccgcagcgtcagcagccgttgcagcgaggtgctggaactgaccgcgaagaacgacgtg
caggccccggtcaacgccgagtga

DBGET integrated database retrieval system