KEGG   Paenibacillus sp. FSL R5-0345: R50345_01155Help
Entry
R50345_01155      CDS       T03333                                 

Definition
(GenBank) 2', 3'-cyclic nucleotide 2'-phosphodiesterase
  KO
K08693  2',3'-cyclic-nucleotide 2'-phosphodiesterase / 3'-nucleotidase / 5'-nucleotidase [EC:3.1.4.16 3.1.3.6 3.1.3.5]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00230  Purine metabolism
paef00240  Pyrimidine metabolism
paef00760  Nicotinate and nicotinamide metabolism
paef01100  Metabolic pathways
paef01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    R50345_01155
   00240 Pyrimidine metabolism
    R50345_01155
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    R50345_01155
Enzymes [BR:paef01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     R50345_01155
    3.1.3.6  3'-nucleotidase
     R50345_01155
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.16  2',3'-cyclic-nucleotide 2'-phosphodiesterase
     R50345_01155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C SLH Metallophos
Motif
Other DBs
NCBI-ProteinID: AIQ33387
Position
236308..240729
Genome map
AA seq 1473 aa AA seqDB search
MGWKTRWNKPLASVLATAVLSLQVFGGIGLGATWGTDKAEAASSATAKLRLMSTTDVHTN
VYGWDYFKNAASTTVGLDRTATLVTYARSEYPLNNLLLDNGDLIQGTPLGTYIANESKLM
ESETKLHPMIAAMNIMEYDVATFGNHEFNYGLEFLNRTIKGYSNNPLTGADFPYVNANIY
IDDKDGNPDNDKNAFDPYVIIKKTIMDSDDQPQVVKVGILGLVTPQIMEWDKVNLEGRVI
AKDIAETAAKFIPAMKNEGADVIVAMAHTGFDATAVAGTDAENAINLLSKVDGIDAITFS
HTHKVFPTGDNASLDASFKDPLTGQPYNSPQSVVDNVYGHINGTPAVQAGYGGGYLGLID
LNLVQEDGKWTVDKKNSKASTRSIANAKPDAVVDAAVAADHQATIDYTGQELGVTTAPMN
SYFAMVQDDPTVQIVTNAQKWYVEKYIENNLPQYKNLPILSVGAPFKAGRNGPSEYTSIE
KGPLTIRSASDLYLYDNTLKAIKVKGSVVKEWVEMSAGAFNTIDEKSTAPQSLLNGDFAV
YNFDIIDGIKYTIDVTKPAKYNPNGTIKNASSSRVKQITYKGKTLDQNQDFIVVTNNYRA
SGGGNFPGVKGSEMLVDSQDENRQILMDYIREVGTIDPSADGNWSLAPISDDVNITFTSS
PEAAKVTPANITDTGAKDIKGFSIYKLALPVKDVEVHLLGINDFHGQLDTVSTVSNKNVG
TAAILATYLKEARAKYDNALLFHNGDSVGASAPVSSLERDEPTIEWMNMMGFDVGSLGNH
EFDQGVDALMTQLYGGVDPKDGNVTHKGTNFDYVNANAVDATTREPIIKPYVIKEVGGVK
IGFIGLVTKATPGKVSPSGTAGVYFLTPEEEVAAVEKYAKELQAKGVETIIVLAHDPAST
KDGVTTGEAADLANALPANSPVDVIVAGDNHALANGTVNGKLIVQAYSYGTAFEDIKLII
DPKTGHVKEKSAVVTSTFHDGVTPDPESVALVNTYLEKHPELTQPVGTTNGTITRTDAYN
NEAALGNLIADAMRTADFGDGAKAADFAFMNPGGIRADLPKGPVTFGDLAKIQPFGNTLV
KLTLTGAQIKTLLQQQWNVKADGTPDIKTLQISGLKYTANMYLPVADRIAKLTLTNGTPI
NPTQKYTAVVNNFMAAGGDNYKVLTQASDSLAGPIDLDVFYDYIVSTFDRKEIKAAVEGR
IVNNLKEVTPTPTPSPTATPTPTTVPTTAPTTAPTTAPTTAPTTAPTTAPTTAPTTAPTT
APTTAPTTAPTATPAPTTAPTATPAPTTAPAANFKDLGKVVWAQEAVQALAAKGIIKGLD
ANSFAPTKTVTRAEFITMLVRALNLTGSATTSSFSDVKQGVWYTDSIAIAVKAGIVQGSG
DGKFEPGRQVTREEMAIMIANALKDKLQPIDKNAALGKFADKSSIAPYAQDAIAQLTQLG
IVNGVEGGKFAPKGIANRAQAAVIIYRMLEQAS
NT seq 4422 nt NT seq  +upstreamnt  +downstreamnt
atgggatggaagacacgatggaacaagccactcgcttctgtactggcaactgcagtgctt
tctttgcaggtgtttggaggaattggtttgggtgcgacttggggtacagacaaagctgaa
gcagcatcctcagctacagccaagctccggttaatgagtaccacagacgtgcacaccaat
gtctacggctgggactactttaagaatgcggcctctacaactgtagggctcgatcgaaca
gctacgttagttacttatgctagaagcgaatatcctcttaataatcttctactcgataac
ggggatctgattcaaggtacaccactggggacttacattgcaaacgaaagtaaactgatg
gaatcagagaccaagctacaccctatgattgcggctatgaatattatggaatatgatgtt
gccacttttggtaatcatgaatttaactatgggctggaattcttaaatcgtactattaaa
ggctatagtaataatccattgactggtgctgatttcccttatgtaaatgccaatatatat
attgatgataaagatggtaatccagacaatgacaaaaatgctttcgacccttatgtcatt
atcaaaaaaacaataatggacagtgatgatcaacctcaggtagttaaggttggtatacta
ggccttgtgacccctcaaatcatggagtgggacaaggttaatctggaaggtcgagttatt
gctaaggatattgcagaaactgcagcgaaatttattcctgccatgaagaacgagggagcc
gatgttatcgtagcaatggcgcataccggcttcgatgcaactgcagttgcgggtactgat
gcagaaaatgctatcaatctgttaagtaaagttgatggtattgatgcaattaccttctcg
cacactcacaaggtgtttccgacaggcgataatgcttcccttgatgcttctttcaaggat
ccattaacaggacagccgtataatagtcctcaatctgttgttgataatgtttatggccac
attaatggtactccagctgtgcaagcaggttatggcgggggttacttgggtctgattgat
cttaatctggtgcaggaagacggcaaatggacagtcgataaaaagaactctaaagcttcg
acccgctccatagccaatgctaaaccggatgctgttgttgatgctgctgtggcagcagat
caccaagctactattgactatacaggtcaagagctaggcgttactactgctccgatgaac
agctattttgcaatggttcaggacgatcctaccgtgcaaattgtgaccaatgcccagaag
tggtatgtggagaagtatattgaaaacaaccttccacagtataaaaatcttccgattctc
agtgtaggtgctccttttaaggctggacgtaacggcccttcggagtacacgagtattgaa
aaaggtccgttgactatccgcagtgcaagtgacttgtacctgtatgacaacacgctaaaa
gctattaaagttaaaggctctgttgttaaggaatgggttgaaatgagtgcgggtgcgttt
aataccatcgatgagaagagcacggctccacaaagcttgctaaatggagattttgcggtt
tataacttcgatattattgatggtattaagtacactattgatgtaactaagcctgcgaaa
tataatcctaacggtacaattaagaatgcttcatccagtcgtgtgaagcaaattacgtat
aaaggtaaaactttggatcagaaccaagatttcattgttgtgactaacaactaccgcgca
agtggcgggggcaatttcccgggtgtgaaaggttcagagatgttggtggattcacaagat
gagaatcgccagatcctcatggactacatcagagaagtaggtaccattgatccttctgcg
gatgggaactggtctttggcccctatctcggacgatgtgaatatcacctttacttcttca
ccagaagcggcaaaagttacgccagccaacattacggatactggtgcaaaagatattaag
ggatttagtatttataaattggctctcccggttaaggatgtagaagttcaccttctggga
atcaatgatttccacggccaactggatacagtttctacagtaagtaacaagaatgtggga
acggctgctattcttgcaacttacctaaaagaagcacgggctaaatacgacaatgctctg
ctctttcataacggagattccgtaggtgcatctgctccggtatcctcgcttgaacgcgat
gagccgacgattgagtggatgaacatgatgggatttgatgtaggttccctgggtaaccat
gaatttgaccaaggtgtcgatgcactgatgacgcagctttatggcggtgtggatcctaag
gacggcaatgttacccacaagggtaccaattttgactatgttaatgccaatgcggtagat
gcgacaacccgcgagccgatcattaaaccttatgtaattaaagaagtgggcggtgtgaag
atcggatttattggtctggtaacgaaggctacaccaggcaaagtttcaccttccggtacc
gctggcgtatatttcctcacacctgaggaggaagtagcggctgttgagaaatatgcgaag
gagcttcaagctaaaggcgtagagacgattatcgtgcttgcgcatgatccagcttctact
aaagacggggtaactacaggtgaggcagctgatctagccaacgcacttcctgcaaattcc
cctgttgacgttattgttgctggtgataaccatgcgctggcaaacggaacagtaaacggt
aagttgattgtacaagcctactcttacggtacagcatttgaagatattaagctgatcatt
gatcctaaaacaggtcatgtgaaggagaagtctgctgtagtgacctccaccttccatgac
ggcgtaacaccggatccggaaagtgtggcactggttaatacttaccttgagaagcatcct
gaacttactcaaccagtgggtacaacaaacggaactatcactcgtaccgatgcttacaac
aatgaggctgcacttggtaacctgatcgctgacgctatgcgtactgctgatttcggcgat
ggcgctaaggctgctgatttcgcctttatgaatccgggtggtatccgtgcggatcttcca
aaaggccctgtaaccttcggcgatctggcgaaaattcagccattcggcaatacgcttgtg
aagctgacgctgactggagcgcaaatcaaaacgttgctgcaacagcaatggaatgtaaag
gctgatggaacacccgatatcaaaacgctgcaaatttctggactgaaatatacagcgaat
atgtatcttccggtagcagatcgcattgccaagcttacgctaactaatggaacaccaatt
aatcctacacagaaatatacggctgtagtgaataactttatggctgcgggcggggataac
tacaaggttctgactcaagctagtgattcattggctggacctattgatttggacgtattc
tacgactatattgtgagcacgtttgatagaaaagagattaaagcagctgttgaaggtcgg
attgttaacaatttgaaggaagtaactccaacgccgacacctagtccaacggcaacacca
acgccaacaacggtaccaacaacagcaccaacaacggcaccaacaacagcaccaacaaca
gcaccaacaacagcaccaacaacggcaccaacaacggcaccaacaacggcaccaacaacg
gcaccaacaacggcaccaacaacagcaccaacagcaacaccagcaccaacaacagcacca
acagcaacgccagcaccaactactgctccagcagcaaacttcaaagatctgggtaaggta
gtatgggcgcaagaagctgttcaagcattggctgctaagggcattataaaaggattggac
gcaaatagttttgcgccaaccaaaacagtgactagagcagagtttattacaatgctggta
cgcgcactgaatctgacgggttcggcaacaaccagttcattcagcgatgttaaacaagga
gtttggtacacggattctatcgctattgcggtgaaggccgggattgtacaagggtctggt
gatggtaagttcgaaccgggtcgtcaagtgacccgagaagagatggctattatgattgct
aatgcattgaaggataaactacagccgattgataagaatgcagcgctgggcaagtttgca
gacaagtccagtattgctccttacgctcaggacgctatagcacaactgacccaattgggg
atcgttaacggtgttgaaggtggcaaatttgcacctaagggcatagctaaccgtgctcaa
gcggcagtcattatctaccgtatgcttgaacaagcttcataa

DBGET integrated database retrieval system