KEGG   Paenibacillus sp. FSL R5-0345: R50345_03005Help
Entry
R50345_03005      CDS       T03333                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00860  Porphyrin and chlorophyll metabolism
paef01100  Metabolic pathways
paef01110  Biosynthesis of secondary metabolites
paef01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    R50345_03005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paef01007]
    R50345_03005
Enzymes [BR:paef01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     R50345_03005
Amino acid related enzymes [BR:paef01007]
 Aminotransferase (transaminase)
  Class III
   R50345_03005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIQ33713
Position
complement(640703..642019)
Genome map
AA seq 438 aa AA seqDB search
MNRSTSEQLYHEALQHIVGGVNSPSRSFKAVGGGAPVFMKRASGSHFWDVDGNEYIDYLQ
AYGPIITGHAHPHITKAITTAAENGVLYGTPTELEIKLAKMLKEAIPSMDKVRFVNSGTE
AVMTTIRVARAYTKRSKIVKFAGCYHGHSDLVLVAAGSGPSTLGIPDSAGVPSSIAQEVI
TVPFNDLDSLQEALEKWGEDVAAVMVEPIVGNFGMVMPKPGFLEGLCKLAHDNGSLVIYD
EVITAFRFHYGSTQTYAGLDNHEDITPDLTALGKIIGGGLPIGAYGGRKHVMEQVAPLGP
AYQAGTMAGNPASISAGIACLEVLSAEGVYDEMERLAIRLVDGLQESADRHGIPLTINRI
RGSFSTHFCKHPVTNYDEAQDTDGELFASFFRHMLNRGINLAPSKYEAWFLTTAHTDADI
DATLIAAEASFAAMASEK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgttccacatctgagcaactttatcacgaagcccttcaacatatcgttggaggt
gtaaatagcccttcccgctcttttaaagctgttggaggcggagcacctgtatttatgaag
cgtgccagtggatctcacttctgggatgtagatggcaatgaatatatcgactatcttcaa
gcctatggaccgatcattaccggccatgctcacccacatataacgaaggcaattaccact
gcagctgagaatggtgttctttacggaaccccaacagagctcgaaattaagcttgctaaa
atgcttaaagaagctattccatctatggataaagtccggtttgtcaattccggcacagaa
gcggttatgactaccattcgtgtcgctcgtgcttatacaaagcgcagcaaaatcgtaaaa
ttcgctggctgttatcacggccactctgatctagtgcttgttgcagcaggatccgggcct
tctacgcttggtattccagatagtgccggcgttccaagcagtattgcacaggaagtaatc
actgttccttttaatgatctagatagcctgcaagaggcactggagaaatggggcgaggat
gtcgccgctgtaatggttgaaccgatcgtcggtaatttcggtatggttatgccgaagcct
ggattcctcgaagggctctgcaagctggctcatgataacggctcactcgttatttatgac
gaagttattactgccttccgcttccactatggttccactcagacctatgcaggactggat
aaccatgaagacattactcctgacctgacagcactcggcaaaatcatcggcggcggccta
ccaatcggcgcgtacggcggtcgtaagcatgtgatggaacaagtagcaccgctaggaccg
gcataccaagcgggaacaatggcgggtaatcctgcttcaatctccgcagggatcgcctgt
ctggaggtgctgagcgcagaaggcgtatacgatgagatggagcggcttgcgatccgtctt
gtcgatggacttcaggaatctgctgaccgtcatggcattccactgacaatcaaccgcatc
cgtggttcattctccactcatttctgtaagcatccggttacgaattacgatgaggcacaa
gatacagatggcgaattgttcgccagcttcttccgtcacatgttgaaccgtgggattaac
cttgccccttcgaaatatgaagcttggttcctaacgacagcacataccgatgcggatatc
gatgctacactgattgcagctgaagcgtcattcgccgctatggcgtctgagaaataa

DBGET integrated database retrieval system