KEGG   Paenibacillus sp. FSL R5-0345: R50345_06455Help
Entry
R50345_06455      CDS       T03333                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00071  Fatty acid degradation
paef00280  Valine, leucine and isoleucine degradation
paef00310  Lysine degradation
paef00362  Benzoate degradation
paef00380  Tryptophan metabolism
paef00620  Pyruvate metabolism
paef00630  Glyoxylate and dicarboxylate metabolism
paef00640  Propanoate metabolism
paef00650  Butanoate metabolism
paef00900  Terpenoid backbone biosynthesis
paef01100  Metabolic pathways
paef01110  Biosynthesis of secondary metabolites
paef01120  Microbial metabolism in diverse environments
paef01130  Biosynthesis of antibiotics
paef01200  Carbon metabolism
paef01212  Fatty acid metabolism
paef02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    R50345_06455
   00630 Glyoxylate and dicarboxylate metabolism
    R50345_06455
   00640 Propanoate metabolism
    R50345_06455
   00650 Butanoate metabolism
    R50345_06455
  09103 Lipid metabolism
   00071 Fatty acid degradation
    R50345_06455
   00072 Synthesis and degradation of ketone bodies
    R50345_06455
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    R50345_06455
   00310 Lysine degradation
    R50345_06455
   00380 Tryptophan metabolism
    R50345_06455
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    R50345_06455
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    R50345_06455
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    R50345_06455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paef04147]
    R50345_06455
Enzymes [BR:paef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     R50345_06455
Exosome [BR:paef04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   R50345_06455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt RnfC_N ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIQ34287
Position
1402705..1403856
Genome map
AA seq 383 aa AA seqDB search
MIEAVIVMAKRTPIGRMGGLLSTLEPEALLAPLIQHIVAETNLPVDIIDDVIIGNVVGPG
GNIARVAALEAGLPVSVPGVTVDRQCGSGLEAINIAARLIQSGAGEIYFAGGVESTSRAP
WKMAKPQTLMGIPQLYTRAHFTPSAYGDPDMGIAAENVARKYGISREEQDQYALKSHQKA
VHAQQSGQFQQEIVPLLVEGEWVHTDECPRVNTSLDKLRKLPPIFEEKGTVTAGNACPIN
DGAALLLMMSREKCRQLKLKPILRVVDAQAAGVDPNYLGMGPVPAVHKVLHRQQLTITDL
DIVEFNEAFASQVLASLNELQIPQEKVNLGGGALAIGHPYGASGAILMTRLFAEMQRTPY
KRGLATLGIGGGMGLATLVEAVE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagcagtgattgtcatggcaaaacgcacaccgattggcaggatgggcggctta
ttaagtacattggagccggaagcattactggcgccgcttattcagcatattgtggcagag
acaaacctgcctgtagatataatcgatgatgtcattattggaaatgtggtcggtccgggt
gggaatattgcccgggtagcagcgctcgaagcgggattgcctgtttcggttccgggtgtc
actgtggatcggcagtgcggttctgggctagaggcgattaatattgcagctaggcttatt
caaagcggtgctggtgagatttatttcgcaggcggcgttgaaagcacgagccgtgctccc
tggaagatggctaagccacagaccttgatgggtattccacagctatatacccgtgctcat
tttacacctagcgcttacggtgatccggatatggggattgctgcggaaaatgtagcgcgg
aagtacgggatttcgcgcgaagagcaggatcaatatgccttaaaaagccatcagaaggcc
gttcatgctcagcaaagtggccagtttcagcaggagattgtacctcttctggttgaggga
gagtgggtgcataccgacgaatgtcctagggtcaatacgagcttggataagctgcgaaag
ctaccgccaatttttgaagaaaagggtactgtcactgctggaaatgcttgtcctattaat
gatggtgcggcgctcttattaatgatgtcccgtgagaaatgtcggcaactcaagcttaag
cctatcctgcgtgtagtggatgcgcaagcggcaggtgtagatccgaactacttaggtatg
gggccagttccagctgtacacaaggtgttacatcgtcaacagctgaccataaccgattta
gatattgtagagtttaatgaagcctttgcttcgcaagttctagcctcactgaacgagctt
cagattccacaggaaaaggtcaatcttggaggaggcgcattagctatcggtcatccatac
ggggcgtccggagccattttaatgacgaggttatttgctgaaatgcagcgtactccttat
aaaaggggacttgccactttgggcatcggcggtgggatggggctggcaacgcttgtggag
gcggtagaatga

DBGET integrated database retrieval system