KEGG   Paenibacillus sp. FSL R5-0345: R50345_07815Help
Entry
R50345_07815      CDS       T03333                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00051  Fructose and mannose metabolism
paef01100  Metabolic pathways
paef01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    R50345_07815
Enzymes [BR:paef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     R50345_07815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIQ34527
Position
1710186..1710836
Genome map
AA seq 216 aa AA seqDB search
MDTLEQKLRLQICDIGRNLFNKDFIAANDGNISARLSENEILTTPRAVSKGYLEPHMIVK
VNLQGEVLEAAEGYRPSTETKMHLRIYNELPEMNGVVHAHPPYATAFAIKGEALDKMMMP
ESVIMIGDIPLAEYGTPSTEEIPDSLMPYLGKKTAVLLENHGALTWGTDVMEAYLNMERL
EYTAKITFITRMIGGERELPQHRIDELVALRSFYGK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggatactttggaacaaaaattacgtttgcagatttgtgatatcggcagaaatctgttt
aataaagatttcatcgccgccaatgatggaaatatttcagcacggttatcagagaatgaa
attcttactactcccagagcggtgagcaaaggatatttagagcctcatatgattgtaaaa
gtaaatctgcaaggtgaagtgcttgaagcggcagaagggtacagaccttcaacagaaact
aaaatgcatttgagaatttataatgagctacctgagatgaatggtgtggttcatgcacat
cccccgtatgccactgcttttgccattaaaggtgaggcactcgataaaatgatgatgccg
gaatcggttatcatgatcggggatatcccattagcggaatatggtaccccttcgacagaa
gaaattccagactcactgatgccttaccttggcaaaaaaacagcagtcctgcttgaaaat
cacggcgcacttacttggggaacagatgttatggaagcctatttgaacatggagagactc
gaatatacggctaaaattacattcattacccgtatgattggcggggagagagaactgccg
cagcatcggattgatgagctggttgcgttgagatctttttatgggaagtaa

DBGET integrated database retrieval system