KEGG   Paenibacillus sp. FSL R5-0345: R50345_09140Help
Entry
R50345_09140      CDS       T03333                                 

Definition
(GenBank) cyclomaltodextrinase
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00500  Starch and sucrose metabolism
paef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    R50345_09140
Enzymes [BR:paef01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     R50345_09140
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     R50345_09140
    3.2.1.135  neopullulanase
     R50345_09140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_N Malt_amylase_C DUF3459 hDGE_amylase GHL10 GHL6 Tape_meas_lam_C
Motif
Other DBs
NCBI-ProteinID: AIQ34762
Position
complement(2048560..2050305)
Genome map
AA seq 581 aa AA seqDB search
MLLEAVYHRPRLNWSYAYNESTIHLRLRAKKGDLTEVFAFAGDKYTWDTTKELIPMTLFT
SDAMFDYWECASVPIYRRLKYGFLLQKDNEKIWMTENDFQTNRPENPNKLFEFPFINPVD
VFTPPAWVKDAVFYQIFPERFANGDPSLDPKDAQPWGAEPTPTNFFGGDLQGVIDHLDHL
NELGINAIYFTPLFTATTNHKYDTEDYMQVDPHFGDIATLKTLVDNCHKRGIRVLLDAVF
NHSGGTFAPFLDVKEKGEDSIYKDWFHIREFPLQVVNGIPTYDTFAFEAHMPKLNTEHPE
VKEYLLKVAEFWITEVGIDGWRLDVANEVDHDFWREFRKVVKRANPEAYILGEIWHESAP
WLEGDKFDAVMNYPFTDAVLDFFVHGSLDAEGFANSIGRQLSRYPLQASEVAFNLLDSHD
TPRLLTLAAGDKNKMRLASLFQFTFMGTPCIYYGDEFGMDGDGDPGCRKCMEWNPEQQDH
NLFEFYRQLIQIRHEQPALRTGTFTFLEAGRQGSKLAYERRIDLETIVVLINSEETAQTF
RIDVDEKNWENLFTGDTVRAERGKLIMKMPAYGFTILKAIV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgttactggaagctgtctatcatcgcccgcggttaaattggtcttacgcctataatgag
agcacgattcatttgcgtctccgcgctaaaaaaggagatttaacagaagtatttgctttt
gcaggagataaatacacttgggataccacaaaagagctaattcccatgaccctcttcacc
tctgatgctatgttcgattattgggaatgtgcctctgttcccatctatcgtagattgaaa
tacggattcttactgcaaaaggataatgagaaaatttggatgaccgaaaatgattttcaa
acgaaccgtccagaaaatccaaacaagctgttcgagttcccatttattaaccccgttgat
gtattcactccacctgcctgggtaaaggatgctgttttctatcagatcttccctgaacgc
tttgcaaatggcgaccctagtcttgatccaaaagatgctcagccatggggagcagagcca
acaccaaccaacttttttggcggcgacctgcaaggggttattgatcatctggatcatctt
aacgagcttggcatcaatgctatttatttcacaccactcttcacagcaactactaatcat
aaatacgatacagaagattatatgcaagttgatccgcattttggggatattgcaacgtta
aaaacactcgtcgataactgccataaacgtggtattcgtgtgctattagacgctgtattt
aatcattccggtggaactttcgctccgtttttggatgttaaggaaaagggagaagactcc
atctacaaagattggttccatattcgtgaattcccacttcaggttgtaaacggcattcct
acttatgacacttttgcgtttgaagcacatatgccaaagcttaatacagaacatcctgaa
gttaaagagtacttgctgaaggtcgcagaattttggatcacagaagttggaatcgatggt
tggcgcctagatgtggccaatgaagtagatcatgatttctggcgtgaattccgaaaagtg
gtaaagcgcgctaatcctgaggcctacatccttggagaaatctggcatgaatctgctccg
tggctggaaggtgataaatttgatgccgttatgaattatccttttactgatgccgtcctt
gacttctttgttcatggaagccttgatgctgaaggattcgccaactctattggccggcag
ttatcgcgctacccactgcaagcaagtgaagttgccttcaatctgttagatagtcatgat
actccgcggttgcttacgctggctgcaggggataaaaataaaatgcgattagcttcacta
ttccaattcacctttatgggtactccttgtatctattatggcgacgagttcggaatggac
ggtgatggtgatccaggttgtcgtaaatgcatggaatggaaccctgaacagcaggatcat
aatctattcgaattctatcgccagctcattcaaatacgccatgagcaaccagcacttcgt
acggggacatttaccttcttggaggcaggtcgacaaggcagtaagctagcctatgagcgc
cgaatagatcttgagactatagttgtactgattaacagtgaagagactgctcagacgttc
cgtattgacgtagacgagaaaaattgggagaacttgttcactggcgatacagtgcgtgca
gaaagaggcaagctaatcatgaagatgcctgcttatggtttcactatacttaaggcaatc
gtttag

DBGET integrated database retrieval system