KEGG   Paenibacillus sp. FSL R5-0345: R50345_30655Help
Entry
R50345_30655      CDS       T03333                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00230  Purine metabolism
paef00250  Alanine, aspartate and glutamate metabolism
paef01100  Metabolic pathways
Module
paef_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    R50345_30655
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    R50345_30655
Enzymes [BR:paef01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     R50345_30655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AIQ38591
Position
complement(6756649..6757935)
Genome map
AA seq 428 aa AA seqDB search
MSTVVVVGTQWGDEGKGKITDFLAESADVVARYQGGNNAGHTILIDGEKFKLSLIPSGVF
YKEKTCVIGNGMVINPAALIQEINYIHENGFDTKNLVISDRAHVIMPYHMVLDALEEDRK
GPNKIGTTRKGIGPCYMDKAARNGIRIADLMDAEEFELRLRHLMEEKNQVITQVYGAEAL
NVEEILTQYLEYAEVLRNYVTDTSVILNEAIDADRKVLFEGAQGVMLDIDQGTYPFVTSS
NPSAGGVCIGSGVGPSKIKQVIGVAKAYTTRVGDGPFPTELNDATGDYIRETGHEYGTVT
GRARRVGWFDSVVVSHARRVSGITGLSLNSLDVLSGLETVKICTGYKYRGEVITHYPASL
KMLAECEAVYEELPGWSEDITSAKTLDDLPANTRRYVERVSELTGIPIAIFSVGRNREQT
NQVIPIYI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacggtagtcgtcgtgggaacacaatggggagacgaaggtaaagggaaaatcact
gactttctagcggaaagtgcagatgtggttgcccgttatcaagggggcaataatgccggt
cacacgattctgattgacggtgagaagtttaagctcagcttaatcccttctggtgtattt
tataaagaaaagacttgtgtaattggtaacgggatggttattaatccagctgccttgatc
caagaaattaattatattcacgagaacggttttgacactaagaacttagtgatcagcgac
cgggctcacgttattatgccttatcacatggtactggatgctctagaagaagaccgcaag
ggtccgaataagattggtacaacacgcaaaggtatcggtccttgttacatggataaggct
gcgcgtaacggtatccgtattgctgacctgatggacgctgaggaattcgaattgagactc
cgtcacttaatggaagagaagaaccaagtgattactcaagtatatggcgcggaagctctt
aatgttgaagagatcctgacccagtacctagaatatgcggaagtactgcgtaactatgtg
acagacacgtcggttattcttaatgaagctattgatgcagaccgcaaagtattgtttgaa
ggtgcacaaggggtaatgcttgatatcgatcaaggtacgtatccatttgtaacttcttct
aacccatctgcaggtggagtatgcataggttctggcgttggaccttccaagattaaacaa
gttatcggggttgctaaagcctacaccactcgtgttggagatggcccgttccctacagaa
ctgaatgatgcaactggagactatatccgtgaaacgggtcatgaatatggcacagttact
ggacgtgctcgccgtgtaggttggttcgacagtgttgttgtaagtcacgctcgtcgtgta
agtggaattacaggcttgtctcttaactcgctggatgtactcagcggacttgagactgtg
aagatctgcacaggctacaaataccgtggtgaagtaatcacgcattacccagctagcctt
aagatgctggcagagtgtgaagcggtatacgaggagcttccaggttggagtgaagatatt
acttctgcaaaaacattggacgatctgccagccaatacacgcagatatgttgagcgtgtg
tctgagcttacaggaattccgattgccatcttctcagtaggccgtaaccgtgagcagacg
aatcaagtaataccaatttatatctaa

DBGET integrated database retrieval system