KEGG   Pseudomonas aeruginosa YL84: AI22_00910Help
Entry
AI22_00910        CDS       T03035                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
paeg  Pseudomonas aeruginosa YL84
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AI22_00910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHH47435
Position
184542..184922
Genome map
AA seq 126 aa AA seqDB search
MSDTQHQVNVRVDTRYLPEQSAPEQNRFAFAYTVTIENQGEVPAQLLSRHWIITDGDGRT
QEVRGAGVVGEQPLIAPGAQHTYTSGTVLATRVGSMRGSYQMLGSDGIAFDAAIPVFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacccagcaccaggtcaacgtcagggtcgacacccgctaccttccggaacag
tccgccccggagcagaaccgtttcgccttcgcctacacggtgaccatcgagaaccagggc
gaggttccggcccaactgctgtcgcgccactggatcatcaccgacggcgacggccgtacc
caggaagttcgcggcgccggcgtggtcggcgagcaaccgctgatcgcccccggcgcgcaa
cacacctacaccagcggcacggtgctggcgacccgggtcggcagcatgcgcggcagctat
cagatgctcggcagcgacggaatcgccttcgacgccgcgatcccggtgtttcgcctggcc
gtaccgggagcgctgcactga

DBGET integrated database retrieval system