KEGG   Pseudomonas aeruginosa YL84: AI22_08890Help
Entry
AI22_08890        CDS       T03035                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
paeg00020  Citrate cycle (TCA cycle)
paeg00620  Pyruvate metabolism
paeg01100  Metabolic pathways
paeg01110  Biosynthesis of secondary metabolites
paeg01120  Microbial metabolism in diverse environments
paeg01130  Biosynthesis of antibiotics
paeg01200  Carbon metabolism
Module
paeg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paeg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AI22_08890
   00620 Pyruvate metabolism
    AI22_08890
Enzymes [BR:paeg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AI22_08890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Amino_oxidase FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AHH48984
Position
complement(1925240..1926763)
Genome map
AA seq 507 aa AA seqDB search
MAQNDHETVDMLLVGAGIMSATLAVLLKELDPNLKMEVVELQESGAIESSNPWNNAGTGH
AGLCELNYTPQSADGSIDIKKAVGINTMFEVSKQFWSHLVAKGTFGSPKTFINPVPHLSF
VRGSEGIAYLKKRFESLTKHHAFETMVYSEDKATLAEWMPLMMPGRPADEAIAATRVEGG
TDVNFGALTNQLLQHLAQQPGAQIHYNQKVTHLRRADNGWRVTVKDTRNGGDREIQARFV
FLGAGGGALPLLQLSGIPEGKGFGGFPVSGQWLRCDNPEIVKQHQAKVYSQAEVGSPPMS
VPHLDTRVVDGKKSLLFGPYAGFSTKFLRHGSFLDLPLSVRPGNILPMLSVARDNMDLTR
YLIGQVMQSPEQRLEALRKFYPEARAEDWRLEVAGQRVQIIKKDPKKGGILQFGTELVAA
HDGSIAALLGASPGASVTVSIMLGLIERCFPEQARSPEWSAKLKEIFPAREKELESDAEL
YRSVSSRCSEVLELTAKNDVQAPVNAE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaacgatcacgaaacagtcgacatgctgctggtaggcgccggcatcatgagc
gcgaccctggcggtcctgctcaaggaactcgaccccaacctgaagatggaagtcgtcgaa
ctccaggagtccggcgcgatcgaaagctccaacccgtggaacaacgcgggcaccggccac
gccggcctgtgcgagctgaactacaccccgcagtcggccgacggcagcatcgacatcaag
aaagccgtgggcatcaacaccatgttcgaggtgtcgaagcagttctggtcgcacctggtc
gccaagggcaccttcggctcgccgaagaccttcatcaacccggtaccgcacctgagcttc
gtgcgcggcagtgaaggcatcgcctacctgaagaagcgcttcgaatcgctgaccaagcac
cacgctttcgagaccatggtctactccgaggacaaggccaccctcgccgagtggatgccg
ctgatgatgccgggtcgtccggccgacgaagcgatcgccgcgacccgcgtcgagggcggt
accgacgtcaacttcggcgccctgaccaaccagctcctgcaacacctggcgcaacagccg
ggcgcgcagatccactacaaccagaaggtcacccacctgcgccgcgccgataacggctgg
cgggtcaccgtcaaggacacccgcaacggcggcgaccgcgagatccaggcacgcttcgtc
ttcctcggcgccggcggcggcgccctgccgctcctgcaactttccggcatcccggaaggc
aagggcttcggtggtttcccggtgagcggccagtggctgcgctgcgacaacccggaaatc
gtcaagcagcaccaggccaaggtctacagccaggccgaggtcggctcgccgccgatgtcc
gtgccgcacctggacacccgcgtggtggacggcaagaaatccctgctgttcggcccctat
gccggtttctccaccaagttcctgcgccatggctcgttcctcgacctgccgctgtcggta
cgcccgggcaacatcctgccgatgctctcggtggcccgcgacaacatggacctgacccgc
tacctgatcggccaggtcatgcagtcgccggaacagcgcctggaagccctgcgcaagttc
taccccgaagccagggccgaggactggcgcctggaagtcgccggccagcgcgtgcagatc
atcaagaaggatccgaagaaaggcggcatcctgcagttcggcaccgagctggtggccgcc
cacgacggctccatcgccgccctgctgggcgcctcgccgggcgcctcggtgaccgtctcg
atcatgctcggcctgatcgagcgctgcttcccggagcaggcccgctcgccggagtggagc
gccaagctgaaggaaatcttcccggctcgcgagaaagagctggaaagcgacgccgagctg
taccgcagcgtcagcagccgttgcagcgaggtgctggaactgaccgcgaagaacgacgtg
caggccccggtcaacgccgagtga

DBGET integrated database retrieval system