KEGG   Pseudomonas aeruginosa YL84: AI22_18085Help
Entry
AI22_18085        CDS       T03035                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
paeg00071  Fatty acid degradation
paeg00072  Synthesis and degradation of ketone bodies
paeg00280  Valine, leucine and isoleucine degradation
paeg00310  Lysine degradation
paeg00362  Benzoate degradation
paeg00380  Tryptophan metabolism
paeg00620  Pyruvate metabolism
paeg00630  Glyoxylate and dicarboxylate metabolism
paeg00640  Propanoate metabolism
paeg00650  Butanoate metabolism
paeg00900  Terpenoid backbone biosynthesis
paeg01100  Metabolic pathways
paeg01110  Biosynthesis of secondary metabolites
paeg01120  Microbial metabolism in diverse environments
paeg01130  Biosynthesis of antibiotics
paeg01200  Carbon metabolism
paeg01212  Fatty acid metabolism
paeg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AI22_18085
   00630 Glyoxylate and dicarboxylate metabolism
    AI22_18085
   00640 Propanoate metabolism
    AI22_18085
   00650 Butanoate metabolism
    AI22_18085
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AI22_18085
   00072 Synthesis and degradation of ketone bodies
    AI22_18085
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AI22_18085
   00310 Lysine degradation
    AI22_18085
   00380 Tryptophan metabolism
    AI22_18085
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AI22_18085
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AI22_18085
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AI22_18085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paeg04147]
    AI22_18085
Enzymes [BR:paeg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AI22_18085
Exosome [BR:paeg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AI22_18085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DSBA
Motif
Other DBs
NCBI-ProteinID: AHH50760
Position
3866523..3867704
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLAGIPAPELGAAVIRRLLEQTGLDAGQVDEVILGQVLTAG
SGQNPARQAAIKAGLPVGVPAMTLNKVCGSGLKALHLGAQAIRCGDAEVIVAGGQENMSL
APYVMPGARTGLRMGHAKLVDSMIEDGLWDAFNDYHMGITAENLAEKYGLTREEQDAFAA
ASQQKAIAAIEGGRFRDEITPIQVPQRKGEPLSFDTDEQPRAGTTVEALAKLKPAFRKDG
SVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLARIASYASAGVDPAIMGIGPVSATRRA
LDKAGWSLEQLDLIEANEAFAAQSLAVGRELGWDAARVNVNGGAIALGHPIGASGCRVLV
TLLHEMIRRDAKKGLATLCIGGGQGVALTLARD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtcatcgtcgccgctacccgtaccgccgtcggcagcttccagggctcg
ctggccggcattcccgcccccgagctgggcgccgcggtaatccgccgcctgctcgaacag
accggtctcgatgccggccaggtcgacgaagtgatcctcggccaggtgctcaccgccggg
tccgggcagaacccggcgcgccaggcggcgatcaaggccggcctgccggtcggcgtgccg
gccatgaccctgaacaaggtctgcggctccggcctcaaggccctgcacctgggcgcccag
gcgatccgctgcggcgacgccgaggtgatcgtcgccggcggccaggagaacatgagcctg
gcgccctacgtcatgcccggcgcccgcaccggcctgcgcatgggccatgcgaagctggtc
gacagcatgatcgaggacggcctgtgggacgccttcaacgactaccacatgggcatcacc
gccgagaacctggcggagaagtacggcctgacccgcgaggagcaggacgccttcgccgcc
gcttcgcagcagaaggccatcgccgccatcgagggcgggcgcttccgcgacgagatcacg
ccgatccaggtcccgcagcgcaagggcgagccgctgagcttcgataccgacgagcagccg
cgcgccggcaccaccgtcgaggccctggccaagctcaagccggccttcaggaaggacggc
agcgtcaccgccggcaacgcctccagcctcaacgacggcgccgccgcggtattgctgatg
agcgcggccaaggccaaggccctgggcctgccggtgctggcacggatcgccagctacgcc
agcgccggggtcgacccggcgatcatgggcatcggcccggtctccgccacccgtcgcgcg
ctcgacaaggccggctggagcctggagcaactggacctgatcgaggccaacgaggccttc
gccgcgcagtccctggcggtgggtcgggaactgggctgggatgccgccagggtcaacgtc
aacggcggcgccatcgcccttggccacccgatcggcgcgtccggctgccgggtgctggtg
accctgctgcacgagatgatccgtcgcgacgcgaagaagggcctcgccaccctgtgcatc
ggcggcgggcagggcgtcgccctgaccctggcccgcgactga

DBGET integrated database retrieval system