KEGG   Pseudomonas aeruginosa YL84: AI22_26340Help
Entry
AI22_26340        CDS       T03035                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
paeg00280  Valine, leucine and isoleucine degradation
paeg00410  beta-Alanine metabolism
paeg00562  Inositol phosphate metabolism
paeg00640  Propanoate metabolism
paeg01100  Metabolic pathways
paeg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AI22_26340
   00562 Inositol phosphate metabolism
    AI22_26340
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AI22_26340
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AI22_26340
Enzymes [BR:paeg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     AI22_26340
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     AI22_26340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC Wtap
Motif
Other DBs
NCBI-ProteinID: AHH52355
Position
complement(5695880..5697373)
Genome map
AA seq 497 aa AA seqDB search
MSVPVRHLIAGAFVEGLGAQRIPVSNPLDNSTLAEIACASAEQVEQAVASARETFASWKE
TPVSERARVMLRYQALLKEHHDELAKIVSSELGKTFEDAKGDVWRGIEVVEHACNVPSLL
MGETVENVARNIDTYSITQPLGVCVGITPFNFPAMIPLWMFPLAIACGNAFILKPSEQVP
LTSVRLAELFLEAGAPKGVLQVVHGGKEQVDQLLKHPQVKAVSFVGSVAVGQYVYHTGTA
HNKRVQSFAGAKNHMVIMPDADKAQVISNLVGASVGAAGQRCMAISVAVLVGAAREWIPE
IRDALAKVRPGPWDDSGASYGPVINPQAKARIERLIGQGVEEGAQLLLDGRGYKVEGYPD
GNWVGPTLFAGVRPDMAIYREEVFGPVLCLAEVDSLEQAIRLINESPYGNGTSIFTSSGA
AARTFQHHIEVGQVGINIPIPVPLPFFSFTGWKGSFYGDLHAYGKQGVRFYTETKTVTAR
WFDSDSVAGTNFSIQMR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcccagtccgccacctcatcgcgggagccttcgtcgaaggtctcggcgcccag
cgcatcccggtcagcaatcccctcgacaacagcaccctggcggagatcgcctgcgccagc
gcggagcaggtcgagcaggcggtggccagtgcccgcgaaaccttcgccagctggaaggaa
accccggtttccgagcgcgcgcgggtgatgctgcgttaccaggcgttgctcaaggaacac
cacgacgaactggcgaagatcgtctccagcgagctgggcaagactttcgaggacgccaag
ggcgacgtctggcgcggtatcgaggtggtcgagcacgcctgcaacgtgccctcgctgctg
atgggcgagacggtggagaacgtcgcccgcaacatcgacacctacagcatcacccagccg
ctgggcgtgtgcgttggcatcaccccgttcaacttcccggcgatgatcccgctgtggatg
ttcccgctggccatcgcctgcggcaacgccttcatcctcaagccttccgagcaggtgccg
ctgaccagcgtgcggctcgccgagctgttcctcgaggccggtgcgccgaagggcgtgctg
caggtggtgcatggcggcaaggaacaggtcgaccagttgctcaagcacccgcaggtgaag
gcggtgtccttcgtcggctcggtcgccgtcggccagtacgtctaccacaccggcaccgcg
cacaataagcgcgtgcagagcttcgccggggcgaagaaccacatggtgatcatgcccgac
gcggacaaggcacaggtcatcagcaacctggtcggtgcctcggtgggcgcggccgggcag
cgctgcatggcgatttcggtggcggtgctggtgggggccgcccgcgagtggattccggaa
atccgcgacgcgctggccaaggtccgccccggcccatgggacgacagcggcgccagctac
ggcccggtgatcaacccgcaggccaaggcgcgcatcgagcgcctgatcggccagggcgtg
gaggagggcgcgcaactgctgctggatggccgcggctataaggtcgagggatacccggac
ggcaactgggtcggcccgacgctgttcgccggggtgcgcccggacatggcgatctaccgc
gaagaggtgttcggcccggtgctctgcctggccgaggtcgacagcctggagcaggcgatc
cgcctgatcaacgaaagcccctacggcaacggcacctcgatcttcaccagctccggcgcc
gcggcgcggaccttccagcaccacatcgaggtcggccaggtgggcatcaacatcccgatt
ccggtaccgctgccgttcttctccttcaccggttggaagggctcgttctacggcgacctg
cacgcctacggcaagcagggcgtgcgcttctacaccgagaccaagaccgtgaccgcgcgc
tggttcgacagcgatagcgtggccgggaccaacttctcgatccagatgcgctga

DBGET integrated database retrieval system