KEGG   Paenibacillus sp. FSL H7-0357: H70357_13705Help
Entry
H70357_13705      CDS       T03358                                 

Definition
(GenBank) ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
paeh00998  Biosynthesis of secondary metabolites - other antibiotics
paeh00999  Biosynthesis of secondary metabolites - unclassified
paeh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paeh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    H70357_13705
   00999 Biosynthesis of secondary metabolites - unclassified
    H70357_13705
Enzymes [BR:paeh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     H70357_13705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: AIQ17595
UniProt: A0A089I3E5
Position
3070286..3071251
Genome map
AA seq 321 aa AA seqDB search
MLYLNDQDIQAIGLEWPDLVESAESAVRILDSGDYAQPVKPYLRYNHPQNRIIAMPAYVG
GDVNAAGIKWISSFPDNIGAGLPRAHSVIILNDPHTGQPSAVLNSPLPSIVRTASISGLM
IRHFMQARPLEKIQLGIIGWGPIGQHHFQMAMALYGDRIERIRIFDLRGADLSGIQSCYR
DRIEVAETWADVYLKSNIFITCTVSDHRYIDLPPAKGCLLLNVSLRDYKPEALASVKAVI
VDDWDEVCRENTDIERLHLEQGLTRTGTRKISDVVCRSGLTEFAEDEPVFFCPMGMAVFD
IATAVYYVKKARKKGIGSELE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacttaaatgaccaggatatccaggcgataggccttgagtggcctgaccttgtg
gagtctgcagaatctgcggtgcgcattcttgattccggtgattacgcacagccagttaag
ccttatctaaggtataaccatcctcaaaaccggattattgcaatgcccgcgtatgtaggg
ggagacgtgaatgcagcagggatcaagtggatttccagcttcccggataatatcggggcc
ggtcttccccgcgcacatagcgttatcatattgaatgatccccatacgggccagccttca
gccgttctgaactcgccgctgcccagcatcgtcaggacagcttcgatcagcgggctgatg
atccgtcactttatgcaggcgcggccgctggaaaagattcagctcggcattatcggctgg
gggccgattgggcagcatcattttcaaatggcaatggctctgtacggtgatcgaattgaa
cgtatccgcatcttcgatctaaggggagccgatctgtcaggaattcagtcctgttacagg
gacaggattgaagtggcagagacctgggcggacgtctatctgaagtctaatatcttcatc
acatgtaccgtatccgatcaccggtatatcgatcttccccctgcaaaaggttgtcttctg
ctgaatgtttctctgcgtgattataagccggaggcgttagcttcggtgaaagctgtcatt
gtcgacgattgggatgaagtgtgccgcgagaatacagacatcgagcggctccatctggaa
caggggctgacccgtaccggcacccgtaagattagcgacgtcgtctgccgaagcggcctg
actgaattcgccgaagatgagccggtctttttctgcccgatggggatggctgtcttcgat
attgcaacagcggtatattatgtaaagaaggccaggaaaaaagggattgggagcgagctt
gagtaa

DBGET integrated database retrieval system