KEGG   Paenibacillus sp. FSL H7-0357: H70357_18555Help
Entry
H70357_18555      CDS       T03358                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
paeh00030  Pentose phosphate pathway
paeh00480  Glutathione metabolism
paeh01100  Metabolic pathways
paeh01110  Biosynthesis of secondary metabolites
paeh01120  Microbial metabolism in diverse environments
paeh01130  Biosynthesis of antibiotics
paeh01200  Carbon metabolism
Module
paeh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
paeh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:paeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    H70357_18555
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    H70357_18555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paeh04147]
    H70357_18555
Enzymes [BR:paeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     H70357_18555
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     H70357_18555
Exosome [BR:paeh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   H70357_18555
  Exosomal proteins of colorectal cancer cells
   H70357_18555
  Exosomal proteins of bladder cancer cells
   H70357_18555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AIQ18476
UniProt: A0A089I2L1
Position
4112609..4114120
Genome map
AA seq 503 aa AA seqDB search
MEATTFVLFGATGDLARRKIYPALYNLFLDHKLHHSFSVIGLGRRELADEAFQAMVERSI
RDFSRREVYDSASVRRFLKAFRYNVLDVGHTEDYLKLLQRVEKQEESMGSSPNRMFYLSV
GPEFFEPIALNIKESGLGAAKGWKRLVIEKPFGHDLLSAQALNLKLSEAFSEDEIFRIDH
YLGKPMVQELDVFQQTNPVLHALWNNRYIANVQITAGETVGVEERAGYYDHVGALRDMFQ
NHMLQLLMMLAIRLPKDSSADEVRYKKKEVMEALEPLEEADIQFQVIRGQYTAGTIKGKP
VPGYLSEPGIPAGSMNDTFIAARLTIDDPFWKGVPFYIRTGKRMKEKSTRIVIEFKEPLK
QNSSAAEDDIPNLLVFEISPNEGITLQLKARDPQHKGKFKAMHIDFHTRSIEVPEAYENL
IYDALHGDPSFFAHWNEVELSWKWVQPILNAFDKNTVPLHSYAAGTFGPVESNQLLAKDG
NHWWLDSAIEEVSELALPDASNF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaaccacatttgttttatttggagcgacaggggatttagcccgaagaaaaatc
taccccgcgctgtataatctgtttctcgaccacaagttgcaccattcattctctgtgatt
ggtcttggcagaagagaacttgctgatgaagcctttcaggctatggtggagcggtccatc
cgggatttctcccggcgggaagtgtatgattctgcgtccgtgcgccgcttcctgaaggcc
ttccgatataatgtgctggatgtggggcatacagaggattatcttaagctgttgcagcgg
gttgagaagcaggaagagagcatgggcagttccccgaaccggatgttctatttatccgtc
ggtcctgagttttttgagccgattgccttgaacattaaggaaagtggcctgggtgctgcc
aagggctggaaacgtctggtgattgagaagcccttcggacatgatctgctgtctgcgcag
gcactgaatctgaagctgagtgaagcgtttagtgaggatgaaattttccggatcgaccat
tacctgggtaagcctatggtgcaggagctggatgtattccagcagacgaatccggtgctt
cacgcactctggaacaaccgctacattgccaacgtgcagattactgcgggggaaacggtg
ggcgtggaagaaagagcgggttattacgatcatgtgggtgcactcagagacatgttccag
aatcatatgctgcagctgctgatgatgcttgcgatccgcttgccgaaagacagctccgca
gatgaggtgcgctacaagaaaaaagaagttatggaagccctggagccgttggaagaagcg
gatatccagtttcaagtgatccgtgggcagtacactgcaggcaccatcaagggcaagccg
gttccaggctatctctctgaaccgggaattccggcaggttcgatgaacgatacatttatt
gcagccagacttacgatcgatgatccattctggaaaggtgtgccgttctatatccgaacc
gggaagagaatgaaagagaaatcgacacggattgtgattgaattcaaagagccgctcaag
cagaactcgtcagccgccgaggatgatatccccaatcttctggtgttcgagatcagcccg
aacgaggggattacgctacagctcaaggcaagagatccccagcacaaggggaagttcaag
gccatgcatattgacttccataccaggtctattgaggtcccggaagcttatgagaacctg
atttatgatgccttacacggagatccgtcattctttgcgcattggaatgaggtggagctg
tcctggaaatgggtgcagccgatcctgaatgcttttgacaagaatacggttcctcttcat
tcctacgctgcgggtacgttcggacctgtagaatcgaatcagctgctggcgaaggatgga
aatcactggtggctcgactctgccattgaagaagtaagcgagctagctttgcctgatgct
tcaaatttttaa

DBGET integrated database retrieval system