KEGG   Paenibacillus sp. FSL H7-0357: H70357_28080Help
Entry
H70357_28080      CDS       T03358                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
paeh00071  Fatty acid degradation
paeh00280  Valine, leucine and isoleucine degradation
paeh00310  Lysine degradation
paeh00362  Benzoate degradation
paeh00380  Tryptophan metabolism
paeh00620  Pyruvate metabolism
paeh00630  Glyoxylate and dicarboxylate metabolism
paeh00640  Propanoate metabolism
paeh00650  Butanoate metabolism
paeh00900  Terpenoid backbone biosynthesis
paeh01100  Metabolic pathways
paeh01110  Biosynthesis of secondary metabolites
paeh01120  Microbial metabolism in diverse environments
paeh01130  Biosynthesis of antibiotics
paeh01200  Carbon metabolism
paeh01212  Fatty acid metabolism
paeh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H70357_28080
   00630 Glyoxylate and dicarboxylate metabolism
    H70357_28080
   00640 Propanoate metabolism
    H70357_28080
   00650 Butanoate metabolism
    H70357_28080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H70357_28080
   00072 Synthesis and degradation of ketone bodies
    H70357_28080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H70357_28080
   00310 Lysine degradation
    H70357_28080
   00380 Tryptophan metabolism
    H70357_28080
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H70357_28080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H70357_28080
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H70357_28080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paeh04147]
    H70357_28080
Enzymes [BR:paeh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H70357_28080
Exosome [BR:paeh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H70357_28080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIQ20136
UniProt: A0A089I787
Position
complement(6109074..6110339)
Genome map
AA seq 421 aa AA seqDB search
MSKVYILGGEQSDYERNWSKEGKSLVGMFREIIEDGFLATNISTDEIKKLNNENKIGAFI
GNFAAENYLSQGHLGAFLTEISDVFYGLPSARYEAACASGSVAIDAAIAKIKSEQYDLAI
VVGIEMMKTVNSKLSGTFLGSASYFEKEAKGVDFPFPNLFSKLADATIEKYNLDAERYMN
NLAEISYINYSNAKRNPKSQTKNWFMSRSQSEMRKTESNPLVGGRLAISDCSQTTDGAAM
VLLASEEYARSYCRRNNLNISDLPYIKGWGHRNAPLTFNSKINESSDNPYLLKWTRTAVE
EAYKKSELEVKDIDLFEVHDCFTSSEYAALSCLGLTDPGKEYEAIESGLISFAGEKPVNP
SGGLIGGGHPVGASGVRMLLDLYKQISNNAGEYQINNARNAMMLNIGGSATTNYTFIVGK
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtatatattctcggtggagaacaaagtgactacgaacgcaattggagtaaa
gagggtaaatcactagttggaatgtttagagaaattatagaggatggatttttagcaact
aatatttcaactgacgaaattaaaaaacttaataatgagaataaaattggagcctttata
ggtaattttgcagcagaaaactatttgtctcagggacatctcggagcattccttacagag
attagtgatgtattctatggtttgccttcagcacggtatgaagcagcatgtgcttcaggc
tcagtagcgatagatgctgctatagccaaaataaaaagtgagcaatatgatttggctatt
gtagtaggtattgagatgatgaagacagtgaatagtaagttgagtggaacgttccttgga
agtgcttcttattttgagaaggaagccaaaggggtcgactttccgtttcctaatttattt
agtaaattagctgatgccactattgaaaaatataatcttgatgctgagcggtatatgaac
aacttagctgagatttcttatattaattattcaaatgctaaaagaaatcctaaatcacaa
acaaaaaattggtttatgagtagatcgcaatctgaaatgcggaaaacggaatctaatcca
ctggttggtggaagattggctattagtgattgttctcaaacaactgatggagcagcaatg
gtacttcttgcttctgaagaatatgcacgtagttattgcaggagaaacaacttgaatatt
agtgaccttccttacataaaaggatggggtcacagaaatgctccattaactttcaattca
aagattaatgaaagtagtgacaatccgtatcttcttaaatggactcgaacagcagttgaa
gaggcatacaaaaaatccgaattagaggttaaggatatagatttgtttgaggttcatgat
tgttttacatccagtgaatatgctgcattatcctgcttgggtttgacagatccaggaaaa
gagtatgaagctattgagtcaggcctgatctcattcgctggtgaaaagccagtgaatcca
agcggtggtttaattggtggggggcatcctgtcggagcttccggagttagaatgttgttg
gatttgtataaacaaatatcgaataatgctggggaatatcaaattaataatgccagaaat
gcaatgatgttaaatattggagggtcagcaacaacaaactatacatttattgtaggaaaa
gattaa

DBGET integrated database retrieval system