KEGG   Pseudomonas aeruginosa PAO1-VE2: N296_3713Help
Entry
N296_3713         CDS       T03170                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paei  Pseudomonas aeruginosa PAO1-VE2
Pathway
paei00071  Fatty acid degradation
paei00072  Synthesis and degradation of ketone bodies
paei00280  Valine, leucine and isoleucine degradation
paei00310  Lysine degradation
paei00362  Benzoate degradation
paei00380  Tryptophan metabolism
paei00620  Pyruvate metabolism
paei00630  Glyoxylate and dicarboxylate metabolism
paei00640  Propanoate metabolism
paei00650  Butanoate metabolism
paei00900  Terpenoid backbone biosynthesis
paei01100  Metabolic pathways
paei01110  Biosynthesis of secondary metabolites
paei01120  Microbial metabolism in diverse environments
paei01130  Biosynthesis of antibiotics
paei01200  Carbon metabolism
paei01212  Fatty acid metabolism
paei02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    N296_3713
   00630 Glyoxylate and dicarboxylate metabolism
    N296_3713
   00640 Propanoate metabolism
    N296_3713
   00650 Butanoate metabolism
    N296_3713
  09103 Lipid metabolism
   00071 Fatty acid degradation
    N296_3713
   00072 Synthesis and degradation of ketone bodies
    N296_3713
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N296_3713
   00310 Lysine degradation
    N296_3713
   00380 Tryptophan metabolism
    N296_3713
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N296_3713
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N296_3713
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    N296_3713
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paei04147]
    N296_3713
Enzymes [BR:paei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     N296_3713
Exosome [BR:paei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N296_3713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGY68409
Position
complement(4021967..4023172)
Genome map
AA seq 401 aa AA seqDB search
MLDAYIYAGLRTPFGRHAGALSTVRPDDLAGLLLARLAETSGFAVDDLEDVILGCTNQAG
EDSRNLARNALLAAGLPARLPGQTVNRLCASGLSAVIDAARAISCGEGRLYLAGGAESMS
RAPFVMGKAESAFSRTLEVFDSTIGARFANPRLVERYGNDSMPETGDNVARAFGIAREDA
DRFAASSQARYQAALEEGFFLGEILPVEVRAGRKGETRLVERDEHPRPQADLAALARLPA
LFAGGVVTAGNASGINDGAAVVLLGDRAIGEREGIRPLARILASASVGVEPRLMGIGPQQ
AILRALQRAGIDLDEVGLIEINEAFAPQVLACLKLLGLDYEDPRVNPHGGAIALGHPLGA
SGARLVLTAARGLQRIERRYAVVSLCVGLGQGVAMVIERCR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcctatatctacgccggcctgcgtacgcctttcggccggcatgccggtgca
ctctcgacggtgcgtccggacgacctggccggcctgctgctggcgcgtctcgcggaaacc
tccgggttcgccgtcgacgacctggaggatgtgatcctcggttgcaccaaccaggccggc
gaagacagccgcaacctggcgcgcaacgcgctgctcgcagccggcctgccggcgcggctg
cccgggcagacggtcaaccgcttgtgtgccagcggactgtcggcggtgatcgacgcggcg
cgcgcgatcagttgcggtgagggccggctgtacctggccggcggcgccgaaagcatgtcc
cgggcgccgttcgtcatgggcaaggcggagagcgccttcagccgcacgctggaggtcttc
gacagcaccatcggcgcgcgcttcgccaaccccaggctggtcgagcgctatggcaacgac
agcatgccggagaccggcgacaacgtggcccgcgccttcggcatcgcccgcgaagacgcc
gaccgtttcgccgcttcttcccaggcgcgctaccaggctgcgctggaggagggctttttc
ctcggcgagatccttccggtggaggtgcgtgccggacgcaagggcgagacgcggctggtg
gagcgcgacgagcatccgcgaccgcaggccgacctggcggccctggcgcgcttgccggcg
ttgttcgccggtggggtagtgaccgccggtaatgcgtctgggatcaacgacggggcggcg
gtagtgctgctgggcgatcgcgcgatcggcgagcgcgagggcatccggccgttggcgcgg
atcctcgccagcgccagcgtcggcgtcgagccccggttgatgggcatcggcccgcagcag
gcgatcctccgcgcgctgcaacgcgccggcatcgacctggacgaggtcggcctgatcgag
atcaacgaagccttcgcgccgcaggtcctggcctgcctgaagttgctcggcctggactac
gaggacccgcgggtcaatccccatggcggcgccattgccctcggccatccgctcggcgcc
tccggtgcgcgcctggtgctcaccgccgcccgcgggctgcaacgcatcgagcggcgctac
gcggtggtcagcctgtgcgtcgggctcggccagggcgtggcgatggtgatcgagcgctgc
cgatga

DBGET integrated database retrieval system