KEGG   Pseudomonas aeruginosa PAO1-VE2: N296_4390Help
Entry
N296_4390         CDS       T03170                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
paei  Pseudomonas aeruginosa PAO1-VE2
Pathway
paei03010  Ribosome
Brite
KEGG Orthology (KO) [BR:paei00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    N296_4390 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:paei03011]
    N296_4390 (rplV)
Ribosome [BR:paei03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    N296_4390 (rplV)
  Bacteria
    N296_4390 (rplV)
  Archaea
    N296_4390 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGY64857
Structure
PDB: 

Position
complement(4765323..4765655)
Genome map
AA seq 110 aa AA seqDB search
MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEIMKKVLESAVANAEH
NEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagccgctaagctgtcgggcgctcgtatctccgcccagaaagcccgcttggtc
gccgaccagatccgcgggaagaaggtgggcgaagcgctcaacctcctggctttcagcagt
aagaaagccgccgagatcatgaagaaagtgctggagtcggccgttgccaacgctgagcac
aacgaaggcgccgatgtggatgacctgaaggtctccaccgtcttcgtcaacgaaggtcgt
tcgctcaagcgcatcatgccgcgtgccaaaggccgtgctgatcgcatcgtgaagcggtct
tgccatatcacggtcaaggttgcggacaagtaa

DBGET integrated database retrieval system