KEGG   Pseudomonas aeruginosa PAO1-VE2: N296_4693Help
Entry
N296_4693         CDS       T03170                                 

Definition
(GenBank) pseudouridine synthase, RluA family protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
paei  Pseudomonas aeruginosa PAO1-VE2
Brite
KEGG Orthology (KO) [BR:paei00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:paei03009]
    N296_4693
Enzymes [BR:paei01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     N296_4693
Ribosome biogenesis [BR:paei03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    N296_4693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 TruB_N
Motif
Other DBs
NCBI-ProteinID: AGY66223
Position
complement(5091933..5092895)
Genome map
AA seq 320 aa AA seqDB search
MSDMIQRAAEVPFELGGQRLDQIAAQLFPEHSRSRLAGWIKDGRLTVDGAVLRPRDIVHS
GAQLVLEAEQEAQGEWLAQDIELEIVYEDEHILVIDKPAGLVVHPAAGHQDGTLLNALLY
HVPDIANVPRAGIVHRLDKDTTGLMVVAKTLEAHTKLVAQLQARSVSRIYEAIVIGVITS
GGTIDAPIGRHGVQRQKMAVVDAGKVAVSHYRVLERFRAHTHTRVKLETGRTHQIRVHMS
HIGYPLVGDPVYGGRFRIPPVASQTLVQTLREFPRQALHARFLELDHPATGVRMKWESPL
PEDFLWLLSLLRQDREAFVG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatgattcaacgcgcggccgaggtgccgttcgagctgggtggccagcgtctc
gaccagatcgccgcccagctttttcccgaacactcccgctcccgtctggccggctggatc
aaggacggacgcctgaccgtcgacggcgccgtgctgcgcccgcgcgacatcgtccacagc
ggcgcgcaactggtcctggaggccgagcaggaagcccagggcgagtggctcgcacaggac
atcgagctggaaatcgtctacgaggacgagcacatcctggtgatcgacaagcccgccggc
ctggtggtccatccggctgccggccatcaggacggcaccctgctgaatgccttgctctac
catgtcccggacatcgccaatgtgccgcgcgccgggatcgtccaccgcctggacaaggac
acgaccggcctgatggtggtggccaagacgctggaggcccacaccaagctggtggcgcaa
ctgcaggcacggtcggtcagccgcatctatgaggcgatcgtgatcggcgtgatcacctcc
ggcggcaccatcgatgcgccgatcggacggcatggcgtgcagcggcagaagatggcggtg
gtcgacgccggcaaggtggcggtcagccattaccgcgtgctggaacgcttccgtgcgcac
acccatacccgggtcaagctggagaccgggcgtacccaccagatccgcgtgcacatgagc
catatcggctatcccctggtcggcgatccggtctacggtgggcgcttcaggattcccccg
gtggccagccagaccctggtccagactcttcgcgagttcccccggcaggcgctgcacgcg
cgcttcctcgaactggatcacccggccaccggcgtgcgcatgaagtgggagtcgccgctg
ccggaagacttcctctggctgctcagcctgttgcgccaggatcgcgaggcgttcgtcgga
tga

DBGET integrated database retrieval system