KEGG   Paenibacillus sp. FSL H7-0737: H70737_03445Help
Entry
H70737_03445      CDS       T03359                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
paej  Paenibacillus sp. FSL H7-0737
Brite
KEGG Orthology (KO) [BR:paej00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    H70737_03445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Nbas_N
Motif
Other DBs
NCBI-ProteinID: AIQ21992
UniProt: A0A089IF35
Position
752271..753263
Genome map
AA seq 330 aa AA seqDB search
METSIWILGIVIFLALAFDFINGFHDTANAIATSVSTRALKPRTAIIMAALMNFVGALMF
TGVAKKIGGSITDPTLLENGLDIIIATLIAAIIWNLITWWLGIPSSSSHALIGALAGAVY
VGAGSSHINWGGFVEIVEGLIFSPIIAFVIGYIIMTVLKWIFAKRSPHTVNKGFRSMQVV
TAALQSFTHGTNDAQKAMGIITFALVTSGRQETMDVIPLWVKVAAATAMALGTSIGGWKI
IKTMGTKIFKIEPINGFAADISAASVIFSATLLHLPVSSTHAITSAILGVGSAKRFSAVK
WGVAGRIVVTWFITIPISAVLAGLIFKIIF
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatcgatatggattcttggaattgttatatttctcgcgcttgcgtttgacttt
attaatggtttccatgatacggccaacgcgattgctacctctgtctctacacgtgcgtta
aaacctcgaacagctattattatggcggcactgatgaactttgtcggagctttgatgttt
acaggtgtagctaagaaaattggcggaagtatcacagaccccacgttgctggaaaatggt
ctggatatcataatagccacgctgattgctgcgattatttggaatttgatcacctggtgg
ctcggaattccgtcctcctcctctcatgcactgatcggcgctttggctggtgcggtatat
gtgggtgcaggttcgtcgcatattaactggggcggatttgtggaaattgtcgagggcttg
atcttctcgccaattattgcatttgttatcggttatatcatcatgacagtcctgaaatgg
atttttgcaaagcgtagtccacatacggttaataagggcttccgctccatgcaggttgtg
acggcggcattacagtcgtttactcatggtacgaatgatgcgcagaaggcgatggggatc
attacctttgcgctcgttacatcaggacgccaagagactatggatgtaatccctctatgg
gttaaggttgctgcggctacggctatggcactcggtacctccattggtggttggaagatt
atcaagaccatgggtacgaagattttcaaaatcgagccgatcaacggcttcgcggctgat
atttccgcggcttccgttattttctcggcaacactgcttcatttgccagtcagctccaca
catgctatcacttcagcgatcctgggtgttggctctgcgaaacgcttctctgccgtgaaa
tggggagtagctggacgtattgtagttacctggtttattacgattccaatcagtgcggta
ttagccggtctgattttcaaaatcattttttaa

DBGET integrated database retrieval system