KEGG   Paenibacillus sp. FSL H7-0737: H70737_06125Help
Entry
H70737_06125      CDS       T03359                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
paej  Paenibacillus sp. FSL H7-0737
Pathway
paej00030  Pentose phosphate pathway
paej01100  Metabolic pathways
paej01110  Biosynthesis of secondary metabolites
paej01120  Microbial metabolism in diverse environments
paej01130  Biosynthesis of antibiotics
paej01200  Carbon metabolism
paej01230  Biosynthesis of amino acids
Module
paej_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
paej_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:paej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    H70737_06125
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    H70737_06125
Enzymes [BR:paej01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     H70737_06125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C E1_dh DXP_synthase_N DUF3343
Motif
Other DBs
NCBI-ProteinID: AIQ22459
UniProt: A0A089JNA2
Position
1367539..1369581
Genome map
AA seq 680 aa AA seqDB search
MSEQEQAIQKEENSTVDNLSITTIRTLAIDAIEKANSGHPGMPMGSAPMGYQLFAKTMKH
NPDHPTWVNRDRFVLSAGHGSMLLYSLLHLSGYDLPMEELKNFRQWGSLTPGHPEVGHTA
GVDATTGPLGQGIGMAVGMAMAEAQLGATYNKDEHKVVDHYTYAICGDGDLMEGISSESA
SLAGHLKLGKLVVLYDSNDISLDGKLNLSFSENVAQRFDAYGWQVLRVEDGNDLPAIAKA
IAEAQAETSKPTLIEVKTVIGYGSPNKQGKGGHGGTHGSPLGAEEAKLTKDFYKWVYEED
FYVPDEVRAHFAEVKKNGIAANKAWDDKFAAYKKAYPELAAQFETVINGDLPEGWDANLP
TYTTEDKAVSTRVASGSALNGLTAGVPQLVGGSADLESSTMTHLNGLTSFTPESYDGRNI
YFGVREFGMAAAMNGIALHTGLKVFGGTFFVFTDYLRPAIRLASIMKLPVTYVLTHDSIA
VGEDGPTHEPIEQLASLRIIPGLTVIRPADANETSAAWAYAMENKENPVALVLTRQNLPI
LAGTVDGVRENIKRGGYVVSDSKNGTPQAQLIATGSEVQLAVKAQAALAEEGIDVRVISL
PSWDLFEKQDKEYRDSVILPGVKARLAIEMAQTFGWERYTGDQGDILGITTFGASAPGDR
VMKEYGFTVENVVSRVKALL
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaagaacaagcgattcaaaaggaagaaaactcaactgtagataacctgtcc
attacaacgattcgtactttggcgattgacgccattgaaaaagcaaactccggccaccca
ggtatgccaatgggttctgcaccaatgggctaccaattgtttgcaaaaacaatgaaacac
aaccctgatcatccaacatgggtaaaccgtgaccgttttgtattgtccgcaggacatggt
tctatgcttctgtacagcttgttgcaccttagtggttatgatctgcctatggaagaattg
aaaaatttccgtcaatggggcagcttgactccgggtcacccagaagtaggtcacaccgct
ggtgtcgatgcaacaacaggtccacttggacaaggtattggtatggctgttggtatggct
atggctgaagctcaattgggagctacctacaacaaagatgaacataaagtggttgaccac
tatacttacgctatttgtggtgatggtgacctgatggaagggatctcttccgagtccgct
tcactcgctggtcatttgaaactgggcaaattggttgtattgtatgattcaaatgatatt
tcccttgatggtaaattgaacctttccttctccgagaacgtggctcaacgttttgatgct
tatggttggcaagtacttcgcgttgaagacggaaatgatcttccggctattgccaaagcg
attgctgaagctcaagctgagactagcaaaccgactttgatcgaagtgaaaactgtaatt
ggttatggtagccctaacaaacaaggtaaaggcggccatggaggtactcacggttcccca
cttggagcagaagaagctaagctgaccaaagatttctacaaatgggtatacgaagaagat
ttctatgtacctgacgaagtgcgtgctcattttgcagaagtgaagaaaaacggaatcgca
gctaataaagcttgggatgacaaattcgcagcttacaaaaaagcatatccagagcttgct
gcacagttcgaaacagtaatcaacggcgatcttccagaaggctgggatgctaaccttcca
acttacactactgaagataaagcagtatcgactcgtgttgcttccggtagtgcgcttaac
ggtctgactgctggtgttcctcagcttgtgggcggttctgctgacttggaaagctccact
atgacgcatttgaatggtttgacatcgttcacaccagaatcttatgatggccgcaacatc
tacttcggcgtacgtgagtttggtatggctgctgcaatgaacggtattgcactgcacaca
ggtcttaaagtattcggaggaacattcttcgtgttcacagactacctgcgtccagccatc
cgtttggcttcgatcatgaaattgccagtaacctatgtactgacacatgacagtattgca
gttggtgaagatggtcctacgcatgaaccaatcgaacaattggcttccctgcgtatcatc
ccaggtctgactgttattcgtccggctgatgctaacgaaacttctgcagcatgggcttat
gctatggaaaacaaagagaatccagttgctttggttctgactcgtcaaaacttgccaatt
cttgctggaacagttgatggcgttcgtgaaaacatcaaacgtggtggttatgttgtttct
gattccaagaatggcactccacaagcacaactgatcgctactggttctgaggtacaattg
gctgttaaagcacaagctgctttggctgaagaaggtatcgatgttcgtgtaatcagcttg
ccaagctgggatctgttcgaaaaacaagataaagaataccgtgattccgtaattcttcca
ggagttaaggctcgtcttgcaatcgaaatggcacaaacctttggctgggaacgttacact
ggtgaccaaggcgatatcctcggtatcactactttcggagcttccgcacctggagacaga
gtaatgaaagaatacggctttactgttgaaaatgtagttagccgtgtgaaagcacttctg
taa

DBGET integrated database retrieval system