KEGG   Paenibacillus sp. FSL H7-0737: H70737_27665Help
Entry
H70737_27665      CDS       T03359                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
paej  Paenibacillus sp. FSL H7-0737
Pathway
paej00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:paej00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    H70737_27665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paej01007]
    H70737_27665
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paej03016]
    H70737_27665
Enzymes [BR:paej01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     H70737_27665
Amino acid related enzymes [BR:paej01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   H70737_27665
Transfer RNA biogenesis [BR:paej03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    H70737_27665
 Prokaryotic type
    H70737_27665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AIQ26273
UniProt: A0A089IUR6
Position
complement(6127773..6129182)
Genome map
AA seq 469 aa AA seqDB search
MALQIYNTMTRSKEQFVPQESGKVKMYVCGPTVYGYMHIGNARPIIVFDMVRNYLEQLGN
EVRYVTNFTDVDDKLIRKAEEMNTSVAEVAEIFINAYREDLEGLGVKPATLNPRVTESME
LIIGFIKELEEKGYAYESGGDVYYRTSKFEDYGKLSRQNLDELQFGIRVEVDSRKEKPED
FVLWKAAKPGEVYWQSPWGNGRPGWHIECSAMAREFLGDTMDIHGGGQDLQFPHHECECA
QTEALTGKPLSNYWMHNGFINIGDEKMSKSLGNGWLVKDIRGQFKAGTIRYFMLSTHYRN
PLNFSVDSMTSAEKSVERISLAESNVKHRLELAAEGAQGEVSLEINDKLSAIVANFHARM
QDDFNTPDAITAMFDWVSLANHTLANSEAAPADFAALLQAFGEMNAVLRLTPEHEEEEIA
SEEVERLIAERVEARKNKNWSRSDEIRDELGRLGILLEDTPQGMRWRRK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggctttacaaatttacaacacaatgacacgcagcaaggagcagtttgtgccccaagag
tcgggcaaagtgaaaatgtatgtatgtggtccaaccgtttatggatatatgcatatcgga
aatgctagacctattattgtctttgatatggtccggaattatttggagcaactcggcaat
gaggtacggtatgttacgaacttcacagatgtagatgataaactgatacgcaaagcagaa
gaaatgaacacttcagtagcagaggttgctgagatttttattaatgcttatcgtgaggat
cttgaagggcttggagtaaaaccggcaacattgaatccgcgggtaacagaaagcatggag
ctgatcattggattcattaaagagctcgaggaaaaagggtatgcctacgagagtggtggc
gatgtatactaccgtacttccaaatttgaagactatggtaagctgtcccgtcagaatcta
gatgaattacagtttggtattcgcgtggaggtagactcacggaaagagaaacctgaggac
tttgtgctgtggaaagcagcaaaaccaggtgaagtgtactggcagagcccgtggggaaat
ggacgcccgggctggcatattgaatgctcggccatggcaagagagttcttgggggatacg
atggacatccacgggggtggacaagatttgcagttcccgcatcatgaatgcgaatgcgct
cagacagaagctctgacgggtaagccactctctaattattggatgcataatggatttatc
aacatcggtgatgaaaaaatgtcgaaatcattgggtaacggatggcttgtgaaagatatc
cgtgggcaatttaaagctggaactattcgttatttcatgctatcgacccattatcgtaat
ccgttgaacttctcggtggattcaatgacttcagctgaaaagagcgtagaacgtatctca
ctagcagaaagtaacgttaagcatcgtcttgaacttgctgctgaaggtgcccagggtgag
gtcagcttagagattaatgataagttatctgctattgtggccaattttcatgctagaatg
caggatgactttaatacccctgatgcgattaccgctatgtttgattgggtgagtcttgca
aaccatacccttgcgaatagtgaagcagcccctgctgattttgctgcgttgctgcaagct
tttggggaaatgaatgctgtgctgcgtttaacacctgagcatgaggaagaagagatcgcg
agtgaagaagttgaacgattgatcgcggagcgggttgaagcgcgtaagaataaaaattgg
agccggtccgatgagattcgtgatgaattaggtcgcttgggcatattgcttgaggatact
ccgcagggaatgcggtggcggcggaaatga

DBGET integrated database retrieval system