KEGG   Paenisporosarcina sp. K2R23-3: D3873_08395Help
Entry
D3873_08395       CDS       T05647                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
paek  Paenisporosarcina sp. K2R23-3
Pathway
paek00010  Glycolysis / Gluconeogenesis
paek00020  Citrate cycle (TCA cycle)
paek00620  Pyruvate metabolism
paek01100  Metabolic pathways
paek01110  Biosynthesis of secondary metabolites
paek01120  Microbial metabolism in diverse environments
paek01130  Biosynthesis of antibiotics
paek01200  Carbon metabolism
Module
paek_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D3873_08395 (pckA)
   00020 Citrate cycle (TCA cycle)
    D3873_08395 (pckA)
   00620 Pyruvate metabolism
    D3873_08395 (pckA)
Enzymes [BR:paek01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     D3873_08395 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_24 AAA_33
Motif
Other DBs
NCBI-ProteinID: AYC29912
UniProt: A0A385YWM2
Position
1662105..1663691
Genome map
AA seq 528 aa AA seqDB search
MNSVNTQTELNELLTGHNVHVQLSVPQLVEKATSRGEAQLTSTGAIKAETGKYTGRSPKD
KYIVDEAISRDKIEWGSVNQPISSDIFSSLYKKVIEYLKSKDELFLFKGYAGADKTSRLS
LQVINEYAWHNLFAHQLFIRPSAEELTTHEADFTIVSAPTFKADPAVDGTASETFIMVSM
QERIILIGGTEYAGEMKKSIFSIMNYLLPEQGILPMHCSANVGEQGDVALFFGLSGTGKT
TLSADADRKLIGDDEHGWSDNGVFNIEGGCYAKAINLTRENEPQIFDAIRFGSVLENVVI
DQKTREADYTDISLTENTRAAYPLQAIDNIVDPSVAGHPKTIIFLTADAFGVLPPISKLT
KEQAMYHFLSGFTSKLAGTERGITSPQAAFSTCYGSPFLPLPATVYAEMLGKKIDEHNAQ
VFLVNTGWTGGEYGVGSRMKLSYTRAMVRAALEGKLNDVPMDKGSVFGVAIPKEVPGVPA
DVLNPREAWSDKAAYDIKAKELADQFKENFKKFGSVSNEISSKGGPVI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagtgaatacccaaaccgaactgaacgaattgttaactggccataatgtgcac
gttcaattatctgttcctcaattagtagaaaaagcaacatctcgtggagaagcacaacta
acttctaccggtgccattaaggcggaaacaggtaaatacacaggacgctcccctaaggac
aaatacatcgtagatgaagcaatttcgcgtgataaaattgaatggggttctgtgaaccaa
ccaatttcatctgacattttttcttctttatataagaaagtaatcgaatatttaaaatca
aaagatgagttattcctttttaaaggatatgcaggagcggacaaaacctctcgtttatcc
ctacaagtaatcaacgaatacgcttggcacaatttgtttgcacatcaattgttcattcgt
ccttctgcagaagagttaacaacacatgaagctgattttacaattgtatctgcaccaaca
tttaaagcagatcctgcagtagatggaacagcttctgaaacatttattatggtgtccatg
caagaacgaattattttaattggtggaactgaatatgctggggaaatgaaaaaatctatt
ttcagcattatgaactacttgttaccagagcaaggaattcttccaatgcactgttcagca
aatgtaggagaacaaggtgatgttgcattgttctttggtctatcaggaacaggaaaaaca
actttatctgctgatgcagatcgtaagctaatcggtgacgatgaacatggctggtcggat
aatggtgtattcaatattgaaggcggatgttacgcaaaagcgattaacttaacacgcgaa
aatgaaccacaaatttttgatgcaattcgttttggttctgttttagagaacgtcgtaatt
gatcaaaaaacgcgcgaagccgattacacagatatttctttaacggaaaacactcgagct
gcttatccgttacaagcaattgataatattgtggatccttctgtagctggtcatccaaaa
acaattattttcttaacagccgatgctttcggtgtgttgcctccaatcagtaagttaaca
aaagaacaagcaatgtatcatttcttgagtggtttcacatcgaaattagctggaactgag
cgtggaattacttctccacaagctgctttctctacttgttatggttctcctttccttcca
ctacctgctacggtttatgcagagatgcttggaaagaaaattgacgaacataatgcgcaa
gtattcttagtaaacactggttggactggtggagaatatggagtaggaagtcgtatgaaa
ctgtcgtatacacgcgcaatggtgcgtgcagctttagaaggcaaattaaatgatgtacca
atggataaaggatctgtttttggagttgccattccgaaagaagttcctggagttcctgca
gacgtattaaatcctcgagaagcatggtcagataaagcagcgtatgatataaaagcgaaa
gaattagctgatcaatttaaggaaaatttcaaaaagttcggttctgtttcaaatgaaatt
tcatcaaaaggtggtcctgtcatttaa

DBGET integrated database retrieval system