KEGG   Paenisporosarcina sp. K2R23-3: D3873_11615Help
Entry
D3873_11615       CDS       T05647                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
paek  Paenisporosarcina sp. K2R23-3
Brite
KEGG Orthology (KO) [BR:paek00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    D3873_11615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AYC30446
UniProt: A0A385YUT5
Position
2255009..2256007
Genome map
AA seq 332 aa AA seqDB search
MDSILILTILVVVFALAFDFINGFHDTANAIATSVSTRALTPRRAVLLAAAMNFVGALTF
TGVAKTITKDIVDPFALQNGSLIILAALLSAIAWNLITWYFGIPSSSSHAIIGSIAGASI
SAAGFAILNYDGFIKILEALLISPFLALTIGFIVMSIFKVVFKNNNLYRSNKGFRYFQVV
TAALQAFTHGTNDAQKAMGIITMALIAANLHTTDDIPLWVRIAAATAMGLGTSIGGYKII
KTVGGKIMKIRPVNGVAADLSSAMIIFGATAIHLPVSTTHVISSAIMGVGSAQRVRGVKW
GVARKIVITWIITLPISAILAALIYQLLALFS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggattccatactcatactaactatactagtcgtggtgtttgcgttagcgtttgacttt
atcaatggttttcacgatacggcaaatgctatcgccacttctgtatctactagagcttta
acgccaagacgtgccgttttattagcagctgcaatgaatttcgttggtgcattaaccttt
acaggtgtcgcaaaaacaattacgaaagatatcgtcgatccttttgctctgcaaaatgga
tccctaattatacttgccgctttactttcggcaatcgcttggaacttgatcacctggtat
tttggcatcccttcgagctcttcccatgcgattattgggtcgattgcaggtgcatccatt
tctgcagcgggttttgctattttaaattacgatggttttattaaaatcttagaagcacta
ctaatttcgccttttttagcattaaccattggatttatcgtcatgagtatttttaaagtg
gtttttaaaaacaacaatttatatcgaagcaacaaggggtttcgttatttccaagttgtg
accgcagcactacaagcatttacacatgggacgaatgatgcccaaaaagcgatggggatt
attacaatggccctaattgcagccaatttgcatacaacagatgatattccgttatgggtt
cgaattgctgcagctacggcaatgggtcttggaacttccattggaggctacaaaatcatt
aaaactgtcggcgggaaaattatgaagatccgcccagtaaacggagtagcagctgattta
tcttctgccatgattatctttggggctacagcaatacatttacccgtttcgacaactcat
gtaatttcttctgctattatgggtgtcggttctgctcaacgtgttcgtggagtaaagtgg
ggagtagcgcgaaaaattgtgattacatggattattacactacctatttccgctatacta
gcagcactcatttatcaattattagcgttgttttcttaa

DBGET integrated database retrieval system