KEGG   Pseudomonas aeruginosa LES431: T223_02130Help
Entry
T223_02130        CDS       T02970                                 

Definition
(GenBank) amine oxidase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00260  Glycine, serine and threonine metabolism
pael00330  Arginine and proline metabolism
pael00340  Histidine metabolism
pael00350  Tyrosine metabolism
pael00360  Phenylalanine metabolism
pael00380  Tryptophan metabolism
pael01100  Metabolic pathways
pael01110  Biosynthesis of secondary metabolites
Module
pael_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pael00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    T223_02130
   00330 Arginine and proline metabolism
    T223_02130
   00340 Histidine metabolism
    T223_02130
   00350 Tyrosine metabolism
    T223_02130
   00360 Phenylalanine metabolism
    T223_02130
   00380 Tryptophan metabolism
    T223_02130
Enzymes [BR:pael01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     T223_02130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 HI0933_like Pyr_redox_3 Thi4 Pyr_redox Lycopene_cycl FAD_oxidored FAD_binding_3 GIDA AlaDh_PNT_C TrkA_N ApbA
Motif
Other DBs
NCBI-ProteinID: AHC63103
Position
462146..463636
Genome map
AA seq 496 aa AA seqDB search
MSLRWLRAAAFLMLGVFSAVALGKDKQPTAIVVGAGLAGLSAAYELQKDGWQVTVLEARP
QVGGRSGLATSEWVGNQKVQPTLNAYLDTFKLKPVPAPDFVRTPSYLIDGLYYSSSDLAL
KQPNVAADLKRFESTLDDLSASISDPLNPASSNTLFALDQMNAARWLDKLNLSPTARLLV
NQRIRSRYDEPSRLSLLYLAQQGRAYRGVDDRDLRAARLPGGSQVLAEAFVKQIKTIKTK
SKVSSIVQAKDGVAVKAGSETYKADYVVLAVPLKALGQIQMTPSLSGTQMSALKGTNYGW
RDQILLKFKRPVWDDKSRLSGEIFSDQGLGMIWVEPALKGGANVLINLSGDNARVLQAFG
DRQMVDQVLIRMNKFYPKMRGAFAGYEIRRYSADPGTGGSYLAYGPGQVTRFWRIWEQPL
SRVAFAGEHTDALYPGTIEGALRSGKRAASQVRDLYAGKTPVIEGAPMVAKAEKVAAPTT
GGEKKNPFAWFTRLFD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaaggtggctgcgcgccgcggcgtttctcatgttgggggtgttcagcgcggtg
gcgctgggcaaggataaacagcctacggcgatcgtcgtcggcgcgggcctggcaggcctg
agcgcggcctacgaattgcagaaggacggctggcaggtcacggtgctcgaagcgcggccg
caggtgggcgggcgttccggcctggctaccagcgaatgggtcggcaaccagaaggtccag
cccacgctcaatgcctacctggacaccttcaagctgaagccggtgccggcgccggacttc
gtccgcacccccagctacctgatcgacggcctgtactacagcagcagcgatctcgcgctc
aagcagccgaacgtcgccgccgacctcaagcgcttcgagtcgaccctggacgatctctcg
gcatcgatctccgacccgctcaaccctgcctcgagcaataccctgttcgccctcgaccag
atgaacgccgcgcgctggctggacaagctgaacctgtcgccgaccgcgcgcctgctggtc
aaccagcgtatccgttcgcgctacgacgaaccgtcgcgcctgtcgctgctctacctcgcc
cagcagggccgcgcctaccgtggcgtcgacgaccgcgacctgcgcgcggcgcgcctgccc
ggcggcagccaggtgctggcggaagccttcgtcaagcagatcaagacgatcaagaccaaa
tccaaggtgtcgagcatcgtccaggccaaggacggcgtcgccgtcaaggccggcagcgag
acctacaaggccgactacgtggttctcgccgtgccgctgaaggcgctcggccagatccag
atgaccccgtccctgagcggtacccagatgtccgcgctgaagggcaccaactatggctgg
cgcgaccagatcctgctgaagttcaagcgtccggtgtgggacgacaagtcgcgcctctcc
ggcgagatcttcagcgaccagggcctgggcatgatctgggtcgagccggcgctgaaaggc
ggcgccaacgtgctgatcaacctgtccggcgacaacgcccgcgtgctgcaggctttcggc
gaccggcagatggtcgaccaggtgctgatccgcatgaacaagttctatccgaagatgcgc
ggtgccttcgccggctacgaaattcgtcgctacagcgccgatccgggtaccggtggttcc
tacctggcctacggtccgggccaagtgacgcgtttctggcggatctgggaacagccgctg
tcgcgggtcgccttcgccggcgagcacaccgatgcgctgtaccccggcaccatcgagggc
gcgctgcgtagcggcaagcgcgcggccagccaggtgcgcgacctgtatgccggcaagacg
ccggtgatcgagggcgcgccgatggtggcgaaggccgagaaggtggccgcaccgacgacc
ggcggcgagaagaagaacccgttcgcctggttcacccgcctgttcgattga

DBGET integrated database retrieval system