KEGG   Pseudomonas aeruginosa LES431: T223_03990Help
Entry
T223_03990        CDS       T02970                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    T223_03990
Enzymes [BR:pael01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     T223_03990
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     T223_03990
    1.1.1.-  
     T223_03990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C DAO Pyr_redox_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AHC63461
Position
complement(845289..846380)
Genome map
AA seq 363 aa AA seqDB search
MNSSPQANAAMRAAVWHGRHDIRVEDVPLPAEPPPGWVQIRVHWCGICGSDLHEYLAGPV
FIPVEAPHPLTGLKDQCILGHEFSGEIVRLGNGVTGFAVGQAVAADACQHCGTCYYCRHG
LYNICENLAFTGLMNNGAFAEYVNVPANLLYALPAGFPSEAGALIEPLAVGMHAVKKAGS
LLGQNVVVVGAGTIGLSTIMCARAAGAAQVIALEMSSARKAKALEVGASQVLDPSRCDAL
GEIRALTGGLGADVSFECIGNKHTAKLAIDAIRKAGKCVLVGIFEEPSEFNFFELVSTEK
QLLGALAYNGEFADVIAFIADGRLDIAPLVTGRIGLEEIVERGFEELVNNKEHNVKIIVS
PGG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaacagttccccgcaagccaacgcggcgatgcgcgccgccgtctggcacggccgccac
gatatccgcgtggaagacgtgccgctcccggccgagccgccgcccggctgggtgcagatc
cgcgtgcactggtgcggcatctgcggctccgacctgcacgaatacctggccggcccggta
ttcatccccgtggaggcgccgcacccgctcaccggcctcaaggatcaatgcatcctcggc
cacgagttcagcggcgaaatcgtccgcctcggcaacggtgtgaccggcttcgccgtcggc
caggcggtcgccgcagacgcctgccagcattgcggcacctgctactactgccggcatggg
ctgtacaacatctgcgagaacctggccttcaccgggctgatgaacaacggcgccttcgcc
gaatacgtcaacgtaccggccaacctgctctacgccctgccggccggatttcccagcgag
gccggcgcgctgatcgagccgctggcggtgggtatgcacgcggtgaagaaggccggcagc
ctgctcgggcagaacgtggtggtggtcggcgccggcaccatcggcctgagcaccatcatg
tgcgcgcgcgccgccggcgcggcacaggtgatcgccctggagatgtcctcggcgcgcaag
gccaaggccctggaggtcggcgccagccaggtgctcgacccctcgcggtgcgacgcccta
ggcgaaatccgcgccctcaccggcgggcttggcgccgacgtcagcttcgaatgcatcggc
aacaagcacaccgccaagctggccatcgatgccatccgcaaggccggcaagtgcgtgctt
gtgggaatcttcgaggagcccagtgaattcaatttcttcgagctggtttccaccgagaag
cagttgctcggggccctcgcctacaacggcgagttcgccgacgtgatcgccttcatagcc
gacggccgcctcgacatcgcaccgctggtgaccggtcgcatcggcctggaagaaatcgtc
gagcgcggtttcgaagagttggtgaacaacaaggagcacaacgtgaagatcatcgtctcg
ccgggcggctga

DBGET integrated database retrieval system