KEGG   Pseudomonas aeruginosa LES431: T223_05740Help
Entry
T223_05740        CDS       T02970                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00230  Purine metabolism
pael00240  Pyrimidine metabolism
pael01100  Metabolic pathways
pael01110  Biosynthesis of secondary metabolites
pael01130  Biosynthesis of antibiotics
Module
pael_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pael_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pael_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
pael_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    T223_05740
   00240 Pyrimidine metabolism
    T223_05740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pael04131]
    T223_05740
Enzymes [BR:pael01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     T223_05740
Membrane trafficking [BR:pael04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    T223_05740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AHC63807
Structure
PDB: 

Position
1221632..1222063
Genome map
AA seq 143 aa AA seqDB search
MALQRTLSIIKPDAVSKNVIGEILTRFEKAGLRVVAAKMVQLSEREAGGFYAEHKERPFF
KDLVSFMTSGPVVVQVLEGEDAIAKNRELMGATDPKKADAGTIRADFAVSIDENAVHGSD
SEASAAREIAYFFAATEVCERIR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcaacgcaccctgtccatcatcaagccggacgccgtttccaagaacgtgatc
ggcgaaatcctgacccgcttcgagaaagccggcctgcgcgtcgtcgccgctaaaatggtt
cagctgtccgagcgtgaagccggtggcttctatgccgagcacaaagagcgtccgttcttc
aaggacctggtttccttcatgacttccggtccggttgtagtccaggtcctggaaggcgag
gacgccatcgccaagaaccgcgagctgatgggcgccaccgatccgaagaaagccgacgcc
ggtaccatccgcgccgacttcgccgtctccatcgacgagaacgccgtccacggttccgat
tccgaagcttccgccgctcgcgagatcgcctacttcttcgcggctaccgaagtctgcgag
cgcattcgctga

DBGET integrated database retrieval system