KEGG   Pseudomonas aeruginosa LES431: T223_05765Help
Entry
T223_05765        CDS       T02970                                 

Gene name
hisS
Definition
(GenBank) histidyl-tRNA synthetase
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pael00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    T223_05765 (hisS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pael01007]
    T223_05765 (hisS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pael03016]
    T223_05765 (hisS)
Enzymes [BR:pael01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     T223_05765 (hisS)
Amino acid related enzymes [BR:pael01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   T223_05765 (hisS)
Transfer RNA biogenesis [BR:pael03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    T223_05765 (hisS)
 Prokaryotic type
    T223_05765 (hisS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b HGTP_anticodon tRNA-synt_2
Motif
Other DBs
NCBI-ProteinID: AHC63812
Position
1226174..1227463
Genome map
AA seq 429 aa AA seqDB search
MSKSLQAIRGMNDILPEQTPAWRYLERTFAGLLDGYGYSEIRLPILEFTELFARGIGEGT
DVVDKEMYTFLDRNGESLTMRPEGTAGCVRAVLEHGLSGGGQVQKLWYTGPMFRYEKPQK
GRYRQFHQIGVEVFNLPGPDIDAELIILTWRLWQKLGMADAVTLQLNTLGSSEARARYRE
ALVAYLQERFEQLDEDSQRRMTTNPLRILDSKVESTQALLVGAPTLHDYLDEESIAHFEG
LKARLDAVGLRYEINQKLVRGLDYYCRTAFEWVTDKLGAQGTVCGGGRYDGLVSQFGGKP
TPGVGFAMGVERLVLLLETLGVIPAELNRPADLYVCAFGEPAELAALTLAEQLRSAIPGI
RLLVNAGAGSFKSQFKKADKSGARFALILGEDEVANRVVGFKPLRDEGEQQSIAWDALPE
HLAACLEQA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagtccctgcaagccattcgtggcatgaacgacatcctgccggagcagactccg
gcctggcgctatctggaacgcaccttcgccggcctgctggacggctacggctacagcgag
atccgcctgcccatcctcgagttcaccgaactcttcgcccgcggcatcggcgaaggcacc
gacgtggtcgacaaggagatgtacaccttcctcgaccgcaacggcgaatccctgaccatg
cgtccggaaggtaccgccggttgcgtgcgcgccgtgctggagcacggcctgagcggcggt
ggtcaagtgcagaagctctggtacaccgggccgatgttccgttacgagaaaccgcagaaa
ggtcgctaccggcagttccaccagatcggcgtggaagtcttcaacctgcccggtccggac
atcgacgccgagttgatcatcctcacctggcgcctgtggcagaagctcggcatggccgac
gcggtgaccctgcagctcaacaccctcggttccagcgaggcccgcgcacgctatcgcgag
gccctggtggcctatctgcaggagcgcttcgagcaactcgacgaagacagccagcggcgc
atgaccaccaatccgctgcgaatcctcgacagcaaggtggagagcacccaggcattgctg
gtcggcgcgccgaccctgcacgactatctcgacgaagaatcgatcgcccacttcgagggt
ctcaaggcccgcctggatgctgtcggactgcgctacgaaatcaaccagaagctggtgcgc
ggcctggactattactgccgcacggctttcgaatgggtcaccgacaagcttggcgcccag
ggcaccgtttgcggcggtggccgctacgacgggctggtcagccagttcggcggcaagccg
accccgggcgtcggtttcgccatgggcgtggaacgcctggtgctgctgctggaaaccttg
ggggtgatccccgccgaactgaaccgtccggccgacctctacgtctgcgccttcggcgaa
ccggccgagctggccgccctgaccctggccgaacagttgcgcagcgccattcccggcata
cgcctgctggtcaacgccggcgccggtagcttcaagagccagttcaagaaggccgacaag
agcggcgcgcgctttgccctgatcctcggggaggacgaggtggccaatcgcgtggtaggt
ttcaagcccctgcgtgacgagggcgagcaacaaagcattgcctgggatgctctgcccgag
cacctggcagcctgtctggaacaggcttga

DBGET integrated database retrieval system