KEGG   Pseudomonas aeruginosa LES431: T223_10660Help
Entry
T223_10660        CDS       T02970                                 

Definition
(GenBank) trans-2-enoyl-CoA reductase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00061  Fatty acid biosynthesis
pael00650  Butanoate metabolism
pael01100  Metabolic pathways
pael01120  Microbial metabolism in diverse environments
pael01200  Carbon metabolism
pael01212  Fatty acid metabolism
Module
pael_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    T223_10660
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    T223_10660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pael01004]
    T223_10660
Enzymes [BR:pael01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     T223_10660
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     T223_10660
Lipid biosynthesis proteins [BR:pael01004]
 Fatty acid synthase
  Component type
   T223_10660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: AHC64752
Position
2242368..2243564
Genome map
AA seq 398 aa AA seqDB search
MIIKPRVRGFICVTTHPAGCEANVKQQIDYVEAKGPVVNGPKKVLVIGSSTGYGLAARIT
AAFGSGADTLGVFFERPGSESKPGTAGWYNSAAFEKFAHEKGLYARSINGDAFSDEVKRL
TIETIKRDLGKVDLVVYSLAAPRRTHPKSGEVFSSTLKPIGKSVSFRGLDTDKEVIKDVV
LEAASDQEVADTVAVMGGEDWQMWIDALLEADVLADGAKTTAFTYLGEKITHDIYWNGSI
GAAKKDLDQKVLGIRDKLAPLGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEQGT
HEGCIEQVDGLYRESLYGAEPRLDEEGRLRADYKELQPEVQSRVEELWDKVTNENLYELT
DFAGYKSEFLNLFGFEVAGVDYEQDVNPDVQIANLIQA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaaaccgcgcgtgcgtggcttcatctgcgtcactacccatccggcaggctgc
gaggccaacgtcaagcaacagatcgactacgtcgaggccaagggccccgtcgtcaacgga
ccgaagaaggtcctggtcatcggttcctccaccggctatggcctggctgcccgcatcacc
gccgcgttcggttccggcgccgataccctcggggtgttcttcgagcgtccgggcagcgag
agcaagccgggcaccgccggctggtacaactcggcggccttcgagaagttcgcccacgag
aaaggcctgtatgcccgcagcatcaatggcgacgctttctccgacgaggtgaagcggctg
accatcgagaccatcaagcgcgatctcggcaaggtcgacctggtggtctacagcctggcc
gcgccgcgccgtacccatccgaagagcggcgaagtgttctcctcgaccctcaagccgatc
ggcaagtcggtcagcttccgtggcctggacaccgacaaggaagtgatcaaggacgtggtc
ctggaggcggccagcgaccaggaagtcgccgataccgttgcggtgatgggcggcgaggac
tggcagatgtggatcgacgcgctgctggaggccgacgtgctggccgacggcgcgaagacc
accgcgttcacctacctgggcgagaagatcacccacgacatctactggaacggttccatc
ggcgcagccaagaaggatctcgaccagaaggtcctcggtatccgcgacaagctcgccccg
ctgggcggcgacgcgcgcgtgtcggtgctcaaggcggtggtgacccaggccagctcggcg
atcccgatgatgccgctgtacctgtcgctgctgttcaaggtgatgaaggagcagggtacc
cacgaaggttgcatcgagcaggtcgacggcctgtaccgggagagcctgtacggcgccgag
ccgcgcctcgacgaggaaggccgcctgcgtgccgactacaaggaactgcagccggaagtg
cagtcccgtgtcgaggagctgtgggacaaggtaaccaacgagaacctttacgagttgacc
gacttcgccggctacaagagcgagttcctcaacctgttcggttttgaggtcgctggggtc
gactacgagcaggacgtcaacccggacgtgcagatcgccaacctgatccaggcctga

DBGET integrated database retrieval system