KEGG   Pseudomonas aeruginosa LES431: T223_15875Help
Entry
T223_15875        CDS       T02970                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00040  Pentose and glucuronate interconversions
pael00053  Ascorbate and aldarate metabolism
pael01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    T223_15875
   00053 Ascorbate and aldarate metabolism
    T223_15875
Enzymes [BR:pael01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     T223_15875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHC65753
Position
complement(3380720..3382303)
Genome map
AA seq 527 aa AA seqDB search
MTAILGHNFIGGARSAAGTLFLQSLDAASGEALPYRFVQATPEEVDAAAEAAASAYPHYR
QLPASRRAEFLDTIAAELDALDDDFVAIVCRETALPATRIQGERSRTSGQLRLFAEVLRR
GDFHGARIDRARPERKPLPRVDLRQCRIGLGPVAVFGASNFPLAFSTAGGDTAAALAAGC
PVVFKAHSGHMATAERVAAAILRAAERTGMPAGVFNMIYGGGVGERLVRHPAIQAVGFTG
SLKGGRALCDMAAARAQPIPVFAEMSSINPVVLLPAALKKRGEAVADELSASVVLGCGQF
CTNPGLVIGIRSAQFSAFLERFAARMDDQPAQTMLNAGTLASYEKGLAALHAHPHVRHLA
GQPQEGRQARPQLFQADVSLLLEGDELLQEEVFGPASVVVEVADHAELKRALHGLHGQLT
ATLIAEAEDLASFADLVPLLEQKAGRLLLNGYPTGVEVCDAMVHGGPYPATSDARGTSVG
TLAIDRFLRPVCYQNYPDAWLPEALKDGNPLGIARLVDGVGTRAAID
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcctcggacacaacttcatcggcggcgcccgcagcgcggccggcacgctc
ttcctgcaaagcctcgacgccgccagcggtgaggcgctgccgtaccgcttcgtgcaagcc
accccggaagaagtggacgccgccgccgaagccgccgccagcgcctacccgcactaccgg
caactgccggccagccgccgcgcggaattcctcgataccatcgccgccgaactcgacgcg
ctggacgacgatttcgtcgccatcgtctgccgtgaaaccgcgctaccggccacgcgcatc
cagggcgaacgcagccgcaccagcggccagctgcgcctgttcgccgaagtcctgcggcgc
ggcgacttccatggcgcgcgcatcgaccgcgcccggcccgaacgcaagccgctgccacgc
gtcgacctgcgccagtgccggatcggcctcggcccggtggcggtgttcggcgcgagcaac
ttccccctggcgttctccaccgccggcggcgataccgccgcggccctggccgccggctgc
ccggtggtgttcaaggcgcacagcggacacatggccaccgccgaacgggtcgctgcggcg
atcctccgcgcggccgagcgcaccggcatgccggcgggcgtgttcaacatgatctacggc
ggcggagtaggggagcggctggtacgccaccccgcgatccaggcggtcggcttcaccggt
tcgctgaagggcggccgcgccctctgcgacatggcggccgcccgggcgcagccgatcccg
gtgttcgccgagatgagcagcatcaacccggtggtgctgctgccggcggcgctgaagaag
cgcggcgaggccgtggccgacgaactgagtgcctcggtggtgctcggctgcggccagttc
tgtaccaatcccgggctggtcatcggcatccgctctgcgcaattctcggcgttcctcgaa
cgcttcgccgcccgcatggacgaccagccggcgcagaccatgctcaacgccggcacgctg
gccagctatgaaaaaggcctggcggcgctgcacgcccacccgcacgtccgccatctcgcc
gggcaaccgcaggagggccgccaggcccggccgcaactgttccaggcggacgtcagcctg
ctgctggagggcgacgagttgctgcaggaagaagtcttcggcccggccagcgtggtcgtc
gaggtcgccgaccacgccgaactgaagcgcgcgctgcatgggctgcacgggcagctcacc
gcgaccctgatcgccgaagcggaagacctggcgtccttcgccgacctggtaccgctcctg
gaacagaaggcaggacgcctgctgctcaacggctacccgaccggcgtggaagtctgcgac
gcgatggtccacggcggcccgtacccggccacttcggacgcccgcggcacctcggtgggc
accctggccatcgaccgtttcctgcgcccggtgtgctaccagaactacccggacgcgtgg
ctgccggaagcgctgaaggatggcaacccattggggattgcgcggttggtggacggggtt
gggacgcgggcggcgattgactga

DBGET integrated database retrieval system