KEGG   Pseudomonas aeruginosa LES431: T223_16965Help
Entry
T223_16965        CDS       T02970                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00071  Fatty acid degradation
pael00072  Synthesis and degradation of ketone bodies
pael00280  Valine, leucine and isoleucine degradation
pael00310  Lysine degradation
pael00362  Benzoate degradation
pael00380  Tryptophan metabolism
pael00620  Pyruvate metabolism
pael00630  Glyoxylate and dicarboxylate metabolism
pael00640  Propanoate metabolism
pael00650  Butanoate metabolism
pael00900  Terpenoid backbone biosynthesis
pael01100  Metabolic pathways
pael01110  Biosynthesis of secondary metabolites
pael01120  Microbial metabolism in diverse environments
pael01130  Biosynthesis of antibiotics
pael01200  Carbon metabolism
pael01212  Fatty acid metabolism
pael02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    T223_16965
   00630 Glyoxylate and dicarboxylate metabolism
    T223_16965
   00640 Propanoate metabolism
    T223_16965
   00650 Butanoate metabolism
    T223_16965
  09103 Lipid metabolism
   00071 Fatty acid degradation
    T223_16965
   00072 Synthesis and degradation of ketone bodies
    T223_16965
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    T223_16965
   00310 Lysine degradation
    T223_16965
   00380 Tryptophan metabolism
    T223_16965
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    T223_16965
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    T223_16965
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    T223_16965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pael04147]
    T223_16965
Enzymes [BR:pael01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     T223_16965
Exosome [BR:pael04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   T223_16965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DSBA
Motif
Other DBs
NCBI-ProteinID: AHC65967
Position
complement(3624797..3625978)
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLAGIPAPELGAAVIRRLLEQTGLDAGQVDEVILGQVLTAG
SGQNPARQAAIKAGLPVGVPAMTLNKVCGSGLKALHLGAQAIRCGDAEVIVAGGQENMSL
APYVMPGARTGLRMGHAKLVDSMIEDGLWDAFNDYHMGITAENLAEKYGLSREEQDAFAA
ASQQKAIAAIEGGRFRDEITPIQVPQRKGEPLSFDTDEQPRAGTTVEALAKLKPAFRKDG
SVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLARIASYASAGVDPAIMGIGPVSATRRA
LDKAGWSLEQLDLIEANEAFAAQSLAVGRELGWDAARVNVNGGAIALGHPIGASGCRVLV
TLLHEMIRRDAKKGLATLCIGGGQGVALTLARD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtcatcgtcgccgctacccgtaccgccgtcggcagcttccagggctcg
ctggccggcattcccgcccccgagctgggcgccgcggtgatccgccgcctgctcgaacag
accggtctcgatgccggccaggtcgacgaagtgattctcggccaggtgctcaccgccggt
tccgggcagaacccggcgcgccaggcggcgatcaaggccggcctgccggtcggcgtgccg
gccatgaccctgaacaaggtctgcggctccggcctcaaggccctgcacttgggcgcccag
gcgatccgctgcggcgacgccgaggtgatcgtcgccggcggccaggagaacatgagcctg
gcgccctacgtcatgcccggcgcccgcaccggcctgcgcatgggccatgcgaagctggtc
gacagcatgatcgaggacggcctgtgggacgccttcaacgactaccacatgggcatcacc
gccgagaacctggcggagaagtacggcctgtcccgcgaggagcaggacgccttcgccgcc
gcttcgcagcagaaggccatcgccgccatcgagggcgggcgcttccgcgacgagatcacg
ccgatccaggtcccgcagcgcaagggcgagccgttgagcttcgataccgacgagcagccg
cgcgccggcaccaccgtcgaggccctggccaagctcaagccggccttcaggaaggacggc
agcgtcaccgccggcaacgcctccagcctcaacgacggcgccgccgcggtattgctgatg
agcgcggccaaggccaaggccctgggcctgccggtgctggcgcggatcgccagctacgcc
agcgccggggtcgacccggcgatcatgggcatcggcccggtctccgccacccgtcgcgcg
ctcgacaaggccggctggagcctggagcaactggacctgatcgaggccaacgaggccttc
gccgcgcagtccctggcggtgggtcgggaactgggctgggatgccgccagggtcaacgtc
aacggcggcgccatcgcccttggccacccgatcggcgcgtccggctgccgggtgctggtg
accctgctgcacgagatgatccgtcgcgacgcgaagaagggcctcgccaccctgtgcatc
ggcggcgggcagggcgtcgccctgaccctggcccgcgactga

DBGET integrated database retrieval system