KEGG   Pseudomonas aeruginosa LES431: T223_20600Help
Entry
T223_20600        CDS       T02970                                 

Definition
(GenBank) alpha-ribazole-5'-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00860  Porphyrin and chlorophyll metabolism
pael01100  Metabolic pathways
Module
pael_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    T223_20600
Enzymes [BR:pael01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     T223_20600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AHC66676
Position
complement(4396337..4396921)
Genome map
AA seq 194 aa AA seqDB search
MSLRLDLLRHGETESGGGFRGSLDDALTARGWAQMRTAVEGGRWDLLVSSPLQRCRAFAE
ELAQRQGIELELENDLRELHFGAWEGRSAAALMDGHSEALGRFWADPYAFTPPGGEPLSE
FEARVLAAQRRLRQRHAGRRVLLVTHGGVIRLLLACARGLPRERLLQVDVGHGALFGLRA
GEGDDRWHECREGE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcgcctggacctcctgcggcatggcgaaaccgagtccggcggcggtttccgc
ggcagcctcgacgacgccttgaccgcgcgtggctgggcgcagatgcgcacggcggtggaa
ggcggacgctgggacctgctggtcagctcgccattgcaacgttgccgcgccttcgccgag
gaactggcgcagcgccaggggatcgagctggaactggaaaacgatctgcgcgaactgcat
ttcggcgcttgggaggggcgctcggcggccgccctgatggacggccacagcgaggcgctc
ggccgcttctgggccgatccctacgcctttaccccgccgggcggcgagccgctgtccgag
ttcgaggcgcgggtgctggccgcccagcgacgcctgcgccagcgtcacgccggccgtcgt
gtgctgctggtgacccatggcggcgtcatacgcctgttgctcgcttgcgcccgtggcttg
ccgcgcgagcgcttgctgcaggtggacgtcggtcatggcgcactgttcggcctgcgcgcc
ggagagggcgacgatcgctggcacgaatgccgggaaggggaatag

DBGET integrated database retrieval system