KEGG   Pseudomonas aeruginosa LES431: T223_22095Help
Entry
T223_22095        CDS       T02970                                 

Definition
(GenBank) hypothetical protein
  KO
K20257  2-aminobenzoylacetyl-CoA thioesterase [EC:3.1.2.32]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00405  Phenazine biosynthesis
pael01110  Biosynthesis of secondary metabolites
pael01130  Biosynthesis of antibiotics
pael02024  Quorum sensing
pael02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    T223_22095
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    T223_22095
   02025 Biofilm formation - Pseudomonas aeruginosa
    T223_22095
Enzymes [BR:pael01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.32  2-aminobenzoylacetyl-CoA thioesterase
     T223_22095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: AHC66970
Structure
PDB: 

Position
complement(4710747..4711652)
Genome map
AA seq 301 aa AA seqDB search
MLRLSAPGQLDDDLCLLGDVQVPVFLLRLGEASWALVEGGISRDAELVWADLCRWVADPS
QVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAWKSESAVRVVERLNRQLLRAE
QRLPEACAWDALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDAL
GEFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLLQLIPGHGGLLRGRLAADGAESAYTE
CLRLCRRLLWRQSMGESLDELSEELHRAWGGQSVDFLPGELHLGSMRRMLEILSRQALPL
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggctttcggctcccggtcaactggatgatgacctgtgcctgttgggggacgtc
caggtgccggtgttcctgctgcgtctcggtgaggcgagctgggcgctggttgaaggaggg
atcagccgggatgccgaattggtttgggcggacctgtgccgctgggtcgccgacccgtcc
caggtgcactactggctgatcacccacaagcactacgaccactgcggcctgctgccctac
ctgtgtccgcggctgccgaacgtacaggtcctggcgtccgagcggacctgccaggcctgg
aagtcggaaagcgcggtgcgggtggtcgagcgcttgaaccggcaactgttgcgtgcggag
cagcggttgcccgaggcctgtgcctgggacgctctgccggttcgcgcggtggccgacggc
gagtggctggagctgggaccgcggcatcgcctgcaggtcatagaggcccacggccacagc
gacgatcacgtggttttctacgacgtgcgacgccgccgcctgttctgcggcgatgccctg
ggcgagttcgacgaggcagagggggtgtggcggccgctggtgttcgacgacatggaggct
tacctggagtccctggaacgtctgcagcgtctgccgaccctgctgcaactgatcccggga
cacggcggcctgctgcgggggcggctggccgcggatggggccgagtcggcctataccgag
tgtctgcgcctgtgccggcggttgctctggcgccagtccatgggcgaatccctcgacgaa
ctgagcgaggagctgcaccgcgcctggggtgggcagagcgtcgacttcctgcccggcgaa
ctgcacctggggagcatgcgccggatgctggagattctctcccgccaggcgctgcctctg
gactga

DBGET integrated database retrieval system