KEGG   Pseudomonas aeruginosa LES431: T223_22720Help
Entry
T223_22720        CDS       T02970                                 

Gene name
phhB
Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00790  Folate biosynthesis
pael01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    T223_22720 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pael04147]
    T223_22720 (phhB)
Enzymes [BR:pael01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     T223_22720 (phhB)
Exosome [BR:pael04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   T223_22720 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AHC67090
Position
4833115..4833471
Genome map
AA seq 118 aa AA seqDB search
MTALTQAHCEACRADAPHVSDEELPVLLRQIPDWNIEVRDGIMQLEKVYLFKNFKHALAF
TNAVGEISEAEGHHPGLLTEWGKVTVTWWSHSIKGLHRNDFIMAARTDEVAKTAEGRK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactcacccaagcccattgcgaagcctgccgcgcagacgccccgcacgtcagc
gacgaagaactgcccgtgctgctgcggcagatcccggattggaacatcgaagtccgcgac
ggcatcatgcagctagagaaggtctacctgttcaagaacttcaagcatgccctggccttc
accaatgccgtcggcgagatatccgaggccgaaggccaccatccgggcctgctgaccgag
tggggcaaagtcaccgtgacctggtggagccactcgatcaagggcctgcaccgcaacgat
ttcatcatggcggcgcgcaccgatgaggtagcgaaaaccgccgaggggcgcaaatga

DBGET integrated database retrieval system