KEGG   Pseudomonas aeruginosa LES431: T223_23200Help
Entry
T223_23200        CDS       T02970                                 

Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00640  Propanoate metabolism
pael01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    T223_23200
Enzymes [BR:pael01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     T223_23200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AHC67183
Position
4942347..4944953
Genome map
AA seq 868 aa AA seqDB search
MNSAHRKPLPGTRLDYFDAREAVEAIQPGAYAKLPYTSRVLAENLVRRCDPATLEASLRQ
LVERKRDLDFPWYPARVVCHDILGQTALVDLAGLRDAIADKGGDPAQVNPVVPVQLIVDH
SLAVECGGYDPEAFAKNRAIEDRRNEDRFHFIDWTKQAFRNVDVIPPGNGIMHQINLEKM
SPVIQARDGVAFPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIVGV
ELSGRRQPGITATDVVLALTEFLRKQKVVGAYLEFYGEGASSLTLGDRATISNMAPEYGA
TAAMFAIDQQTIDYLRLTGRDDEQVALVEAYARTAGLWADSLVDAEYERVLKFDLSSVVR
NMAGPSNPHARVATSELAAKGIAGNLERARAEEAEGLMPDGAVIIAAITSCTNTSNPRNV
IAAGLLARNADRLGLVRKPWVKTSLAPGSKVVTEYLREAGLLPHLEALGFGVVAYACTSC
NGMSGALDPAIQQEIVERDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTI
RFDIERDVLGVVDGKEIRLKDLWPSDEEIDAVVRAAVKPEQFRQVYIPMFDITHGEREKV
DPLYAWRPTSTYIRRPPYWEGALAGERTLRGMRPLAVLPDNITTDHLSPSNAILADSAAG
EYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVRNADGSVKQGSLARVEPEG
KVMRMWEAIETYMERKQPLIIVAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTN
LIGMGVLPLEFKPGTTRLTLGIDGSETFDVLGARRPRADLTLVIHRRDGERLEVPVTCRL
DSDEEVSIYEAGGVLQRFAQDFLEAAGA
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcgcacaccgcaaaccgctccccggcacccgcctggactacttcgacgcccgc
gaggcggtcgaggcgatccagcccggcgcctacgccaagctgccctatacctcccgcgtg
ctcgccgagaacctggtgcgccgctgcgacccggcgaccctggaggcttcgctgcgccaa
ctggtcgagcgcaagcgcgacctcgacttcccctggtacccggcgcgggtggtctgccat
gacatcctcgggcagaccgcgctggtcgacctcgccggcctgcgcgacgccatcgccgac
aagggcggcgacccggcccaggtcaacccggtggtgccggtgcaactgatcgtcgaccac
tcgctggcggtggaatgcggcggctacgaccccgaggccttcgccaagaaccgcgccatc
gaggaccgccgcaacgaggaccgcttccacttcatcgactggaccaagcaggccttccgc
aacgtcgacgtgatcccgccgggcaacggcatcatgcaccagatcaacctggagaaaatg
tcgccggtgatccaggcgcgcgacggcgtggccttccccgatacctgcgtgggcaccgac
agccataccccgcacgtcgacgccctgggcgtgatcgccatcggcgtcggcggcctggaa
gcggaaaacgtgatgctcggccgcgcctcctggatgcgcctgccggacatcgtcggcgtc
gagctgagcggccgtcgccagccgggcatcaccgccaccgacgtggtgctggccctgacc
gagttcctgcgcaagcagaaggtggtcggcgcctacctggagttctacggcgaaggcgcc
tccagcctgaccctcggcgaccgcgcgaccatctccaacatggctccggaatacggcgcc
actgcggcgatgttcgccatcgaccagcagaccatcgactacctgcgcctcaccggccgc
gacgacgagcaggtcgccctggtggaggcctatgcgcgcaccgccggactctgggccgac
agcctggtcgacgccgagtacgagcgggtactgaagttcgacctgtccagcgtggtgcgc
aacatggccggcccgtccaatccgcacgccagggtcgccaccagcgaactggcggcgaaa
ggcatcgccggcaacctcgagcgggcccgcgccgaggaagccgagggcctgatgccggac
ggcgcggtgatcatcgccgcgatcaccagttgcaccaacaccagcaacccgcgcaacgtg
atcgccgccggcctgctggcgcgcaacgccgaccgcctcggcctggtccgcaagccatgg
gtgaagacctcgctggcacccggctccaaggtggtcaccgaatacctgcgcgaagccggc
ctgctgccgcacctggaagccctcggcttcggcgtggtggcctacgcctgcacgtcttgc
aacggcatgtccggcgccctcgacccggcgatccagcaggagatcgtcgagcgcgacctg
tacgccaccgcggtgctctccggcaaccgcaacttcgacgggcgcatccacccctacgcc
aagcaggccttcctcgcctcgccgccgctggtggtggcctacgccatcgccgggaccatc
cgcttcgacatcgagcgcgacgtgctcggcgtggtggacggcaaggagatccgcctgaag
gacctctggccgagcgacgaggagatcgacgcggtggtcagggcggcggtgaagcccgag
cagttccgccaggtctacatcccgatgttcgacatcacccacggcgagcgcgagaaggtc
gacccgctctacgcctggcgcccgacgagcacttacatccgccgcccgccgtactgggaa
ggcgccctcgccggcgaacgcaccctgcgcggcatgcgcccgctggcggtgctgccggac
aacatcaccaccgaccacctgtcgccgtccaacgcgatcctcgccgacagcgcggcgggc
gaatacctggcgaaaatgggcctgcccgaggaggacttcaactcctacgccacccaccgc
ggcgaccacctcaccgcacaacgcgcgaccttcgccaacccgaagctgttcaacgagatg
gtgcgcaacgccgacggcagcgtgaagcagggttcgctggcgcgggtcgagccggaaggc
aaggtgatgcgcatgtgggaagccatcgagacctacatggagcgcaagcagccgctgatc
atcgtcgccggcgccgactacgggcagggttcttcgcgcgactgggcagccaagggcgtg
cgcctggccggggtggaggcgatcgtcgccgagggcttcgagcgcatccaccgcaccaac
ctgatcggcatgggcgtgctgccgctggagttcaagccgggtaccactcgcctgaccctg
gggatcgacggcagcgagaccttcgacgtgctcggcgctcgccggccgcgcgccgacctg
accctggtcatccaccggcgcgacggggagcggctcgaagtgccggtgacctgccgcctg
gacagcgacgaggaagtctccatctacgaagccggcggcgtactgcaacgcttcgcccag
gacttcctggaggcggccggcgcctga

DBGET integrated database retrieval system