KEGG   Pseudomonas aeruginosa LES431: T223_23825Help
Entry
T223_23825        CDS       T02970                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pael00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    T223_23825
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pael03400]
    T223_23825
Enzymes [BR:pael01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     T223_23825
DNA repair and recombination proteins [BR:pael03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     T223_23825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD AAA_11 Viral_helicase1 SH3_13 AAA_22 AAA_17 UvrD-helicase AAA_16 AAA_28 DUF2075 Mg_chelatase PhoH NTPase_1 T2SSE AAA_25
Motif
Other DBs
NCBI-ProteinID: AHC67301
Position
complement(5086257..5088422)
Genome map
AA seq 721 aa AA seqDB search
MNPTLKQLAGEVRDGRDDQVAQPLAVRHDLLRQLDLWVARGWLRALDRAFVAFLVELQPQ
ADPRVLLAAALTSHQLGHGHVCLDLEATLGAPDAALSLPPEGDEGRDVLLPSQLLHGVRL
DAWREALAASPLVEVVDERPGDPEPSETATSPLVLCAQRLYLRRYWRHELEIALALRERL
GRQAPLAADLAPRLAALFAQAPTEDGQRVTDWQKLACALAARGYFSLITGGPGTGKTTTV
VRLLGLLQAPAVAAGQPLRIRLAAPTGKAAARLSESIGQQVRALPLAEDVLQAIPAEVTT
LHRLLGSRPDTRHFRHHRDNPLALDVLVVDEASMIDLEMMASLLDALPPQARLILLGDKD
QLASVEAGAVLGDLCRDAEEGCYSAETRAWLQRVSGETWQGLREGSAQAHPLAQQTVMLR
HSRRFGASSGIGRLARLVNRQQAGDARALLDSPPADLFDLRLRGERDAAFARLFVDGHPQ
APGTPYGYRHYLQRLAEGRPAAGLALEDGAWERWAQSVLTAFDAFRLLCALRRGPWGVEG
LNQRVAAELLRLGLIEADHGWYEGRPVLVTRNDYSLGLMNGDIGIALRLPERNDDGSLRF
ALRVAFPRNDGSGGVRFVLPSRLVEVDTVFAMTVHKSQGSEFAHTALVLPDALNPVLTKE
LVYTGITRARDWFSLVESLPGVFEEAVRRKVRRLSGLMLHLRPEREEQPPHAPGEQTELP
F
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgaccctcaagcaactggccggcgaagtccgcgatggccgcgacgatcaggta
gcgcaaccgctggcggtacgccacgacctgctgcgtcagctcgacctgtgggtggcgcgc
ggctggctacgggcgctggaccgggcgttcgtcgccttcctcgtcgagttgcagccgcag
gccgatccccgggtgctgctggcggcggcgctgaccagccaccaactgggccacggtcac
gtctgcctggacctggaggcgaccctcggcgcgcccgacgcggcgctctcgctgccgccg
gaaggcgacgaaggccgcgatgtgctgttgccgtcgcaactgctgcacggcgtgcgcctc
gacgcctggcgcgaggccctggcggcgtcaccgctggtggaggtggtcgacgagcgccca
ggcgatcccgagccgagcgagacggcgacctcgccgctggtgctttgcgcccagcgtctc
tacctgcgtcgttattggcggcacgagttggagatcgccctggccctgcgcgagcgcctg
ggtcggcaggcgcccctggccgccgacctggcgccgcgcctggccgcgctgttcgcgcag
gcgccgacggaagacggccagcgcgtcaccgactggcagaagctggcctgcgccctggcg
gcccgcggctatttcagcctgatcaccggcggtcccggtaccggcaagaccaccaccgtg
gtgcgcctgctcggtctgctccaggctccggcggtagccgccggccagccgctgcgcatc
cgcctcgcggcgcctaccggcaaggccgcggcgcgtctctccgaatccatcggccagcag
gtccgggccctgccgctggcggaagacgtgttgcaggcgatccccgccgaggtcactacc
ctgcaccgtctgcttggcagccgtccggatacccggcacttccgccaccaccgggacaac
cctttggcgctggacgtgctggtggtggatgaggcctcgatgatcgacctggaaatgatg
gccagcctgctcgatgcgctaccgccgcaggcgcgcctgatcctgctcggcgacaaggac
cagttggcctcggtagaggccggcgcggtgctcggcgatctctgccgggatgccgaggag
ggctgttacagcgccgagacccgcgcctggttgcagcgggtcagcggcgaaacctggcag
ggcttgcgcgaaggttcggcgcaggcgcatccgctggcgcaacagaccgtcatgctgcgg
cattcccggcgcttcggcgcgagcagcgggatcgggcgcctggcgcggttggtcaaccgg
caacaggccggcgacgcgcgcgcgctgctggacagtccgcccgccgacctcttcgacctg
cgcctgcgcggggagcgcgatgcagccttcgcccggctgttcgtcgacggtcatccgcag
gcgccgggcacgccgtacggctaccggcactacctacaacgcctggccgagggccgcccg
gccgccggactggcgctggaggatggcgcctgggagcgctgggcgcagtcggtactgacg
gctttcgacgccttccgcctgctctgcgcgctgcgccgcggcccatggggcgtggaagga
ctgaaccagcgggtagcggcagaactgctgcgccttggcctgatcgaggccgatcacggc
tggtacgaggggcggccggtactggtgacgcgcaacgactacagcctggggctgatgaac
ggcgatatcggcatcgccctgcgcctgcccgagcgcaacgacgacggcagcctgcgcttc
gcgctgcgcgtggccttcccgcgcaacgacggtagcggcggcgtgcgcttcgtcctgccg
agccgcctggtcgaggtggacaccgtgttcgccatgaccgtgcacaagtcgcagggttcg
gagttcgcccataccgcgctggtcctgccggacgcgctgaacccggtgctgaccaaggag
ctggtgtacaccggtatcacccgcgcccgcgactggttcagcctggtggaaagcctgccc
ggggtgttcgaggaagcagtgcggcgcaaggtgcgccggctcagcgggctgatgctgcat
ctgcggccggaaagggaagagcagccgccgcatgctccgggtgaacagaccgagctgccg
ttctga

DBGET integrated database retrieval system