KEGG   Pseudomonas aeruginosa LES431: T223_29710Help
Entry
T223_29710        CDS       T02970                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00260  Glycine, serine and threonine metabolism
pael01100  Metabolic pathways
pael01110  Biosynthesis of secondary metabolites
pael01120  Microbial metabolism in diverse environments
pael01130  Biosynthesis of antibiotics
pael01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    T223_29710
Enzymes [BR:pael01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     T223_29710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHC68444
Position
complement(6376282..6377322)
Genome map
AA seq 346 aa AA seqDB search
MTDHTQQFASDNYSGICPEAWAAMAEANRGHERAYGDDQWTARASDYFRQLFETDCEVFF
AFNGTAANSLALAALCQSYHSVICSETAHVETDECGAPEFFSNGSKLLLAQTEVGKLTPA
SIRDIALKRQDIHYPKPRVVTLTQATEVGTVYRPDELKAISATCKELGLHLHMDGARFSN
ACAFLGCSPAELSWKAGVDVLCFGGTKNGMAVGEAILFFNRDLAEDFDYRCKQAGQLASK
MRFLAAPWVGVLQDDAWLRYADHANRCARLLVELVADVPGVSLMFPVEANGVFLQLSEPA
IEALRARGWRFYTFIGEGGARFMCSWDTDIERVRELARDIRLVMGA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacacccaacagttcgccagcgacaactattccggcatctgccccgaagcc
tgggcggcgatggccgaagccaaccgcggccacgaacgcgcctatggcgacgaccagtgg
accgcgcgtgcttcggactacttccgccagttgttcgagaccgattgcgaagtgttcttc
gccttcaacggcaccgccgccaactccctggccctggctgcgctgtgccagagctaccac
agcgtgatctgctcggagaccgcccacgtcgagaccgacgagtgcggcgcgccggagttc
ttctccaatggctccaagctgctgctggcgcagaccgaggtcggcaagctgaccccggcg
tcgatccgcgacatcgctctcaagcgccaggatatccactatccgaagccgcgcgtggtg
actctcacccaggccaccgaggtcggcacggtgtaccgcccggacgagctgaaggcgatc
agcgccacctgcaaggagctcggcctgcacctgcacatggacggcgcgcgcttctccaac
gcctgcgccttcctcggctgctcgccggcggagctgagctggaaggccggggtcgacgtg
ctctgcttcggcggcaccaagaacggcatggcggtgggcgaggcgatcctgttcttcaac
cgcgacctggccgaggacttcgactaccgctgcaagcaggccggccaactggcctcgaag
atgcgcttcctcgccgcgccctgggtcggcgtactgcaggacgatgcctggctgcgctac
gccgatcacgccaaccgctgcgcgcgcctgctggtcgagctggtggccgacgttcccggc
gtcagcctgatgttcccggtagaagccaacggcgtgttcctacagctttccgagccggcg
atcgaagccttgcgcgcgcgcggctggcgcttctacaccttcatcggtgaaggtggcgcg
cgtttcatgtgttcctgggataccgatatcgagcgggtccgcgaactggcgcgggacatc
cgcctggtgatgggcgcctga

DBGET integrated database retrieval system