KEGG   Pseudomonas aeruginosa LES431: T223_29915Help
Entry
T223_29915        CDS       T02970                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00051  Fructose and mannose metabolism
pael00520  Amino sugar and nucleotide sugar metabolism
pael01100  Metabolic pathways
pael01110  Biosynthesis of secondary metabolites
pael02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    T223_29915
   00520 Amino sugar and nucleotide sugar metabolism
    T223_29915
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    T223_29915
Enzymes [BR:pael01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     T223_29915
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     T223_29915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase NTP_transf_3 Cupin_2 VEK-30
Motif
Other DBs
NCBI-ProteinID: AHC68485
Position
complement(6425893..6427332)
Genome map
AA seq 479 aa AA seqDB search
MLIPVVLSGGAGTRLWPVSREGQPKPFMRLPDGQTLLGKTYRRAAGLLAGHGEIVTVTNR
EHYFQSKDQFQAARLGRHRGHFILEPTGRNTAPAIAVAALALQAEHGDAAVLVVMPADHL
IRNEEAFREAVGHAARLAVAGHLVTFGVVPDAAETGFGYIELGDRLDEQGAAKVRRFVEK
PDEETARRYVESGGFLWNSGMFCFTASTLVDELAQHAPALLEQARACLAASAAVKMADGI
QHELAGEAFAALPDISIDYALMERSARVAVVPAAFDWSDIGSWGAMSALLDADAEGNRGS
GDTLFVDTRNTFVQSDGRLVATVGVDDLVVVDTSDALLIARADRVQEVRRVVQRLKDERH
EAYRLHRTVNRPWGSYTVLEEGPRFKIKRIVVRPGERLSLQMHHHRSEHWIVVQGMARVT
NGDGARLVNSNESTYIPAGHRHRLENPGVIDLVMIEVQSGEYLGEDDIVRFEDQYGRVV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgctgattcccgtggtgctttccggcggcgccggtacccgcctttggccggtgtcgcgt
gaaggacagccgaagccgttcatgcgcctgcccgatggccagaccctgctgggcaagacc
taccgacgtgccgccgggctcctggccgggcatggcgaaatcgtcacggtgaccaaccgc
gagcattacttccagagcaaggaccagttccaggcggcccgcctggggcggcatcgggga
catttcatcctcgaaccgaccggacgcaacaccgctccggcgattgccgtcgccgccctg
gcgctgcaagccgaacatggcgacgcggcggtactggtggtgatgccggcggatcacctg
atccgcaacgaggaggccttccgcgaggcggtggggcatgccgcgcgtctcgccgtcgcc
gggcacctggttaccttcggcgtggtgccggatgcagcggaaaccggtttcggctatatc
gagctgggcgaccggctggacgagcagggggcggccaaggtgcgccgcttcgtcgagaaa
cccgatgaggaaaccgcccgtcgctacgtggaaagtggcggtttcctgtggaactccggg
atgttctgtttcacggcctcgaccctggtcgacgagctggcgcagcatgccccggccctg
ctggagcaggccagggcctgcctggccgccagtgcggcggtgaagatggccgatggcatc
cagcatgagctggcgggcgaagccttcgccgcgctgccggacatttccatcgactatgcg
ctgatggagcgctccgcgcgggtcgccgtggtgccggcggccttcgactggagcgatatc
ggttcctggggcgcgatgagcgcgctgctcgacgcggacgcagagggcaatcgcggcagc
ggcgacaccctgttcgtcgacacccgtaacaccttcgtgcagagcgacgggcgcctggtc
gccacggtcggggtcgacgacctggtcgtggtggatacttccgatgcgctgctgatcgcc
cgcgccgaccgggtccaggaggtgcgcagggtggtgcagcggctgaaggacgagcggcac
gaggcctatcggctgcatcggaccgtcaaccgtccctggggcagctataccgtcctcgag
gaggggccgcgcttcaagatcaagcgaatcgtggtcaggccgggagagcgcttgtcgctg
cagatgcaccatcaccgcagcgagcactggatcgtggtgcaaggcatggccagggtcacc
aatggcgatggcgcgcggctggtcaacagcaacgagtcgacctacattcccgcgggccac
cggcatcgcctggaaaacccgggggtcatcgacctggtgatgatcgaggtgcagagcggc
gaatacctgggagaggacgacatcgtccgcttcgaggaccagtacggcagggtggtctga

DBGET integrated database retrieval system