KEGG   Pseudomonas aeruginosa MTB-1: U769_17380Help
Entry
U769_17380        CDS       T02951                                 

Definition
(GenBank) protein phosphatase
  KO
K11915  serine/threonine protein phosphatase Stp1 [EC:3.1.3.16]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
paem02025  Biofilm formation - Pseudomonas aeruginosa
paem03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paem00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    U769_17380
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    U769_17380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paem02044]
    U769_17380
Enzymes [BR:paem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     U769_17380
Secretion system [BR:paem02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   U769_17380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP2C_2 PP2C SpoIIE
Motif
Other DBs
NCBI-ProteinID: AHB56710
Position
complement(3761616..3762344)
Genome map
AA seq 242 aa AA seqDB search
MQRTEPWRSAARTDRGKVRARNEDAFLDCPDRGLWAVADGMGGHQAGDLASRMIVTSLAE
LPARAGFDERLNAMRQCLHWLNRRLGEELTLSAERGDRIIGSTVVALVVEGSRAACVWVG
DSRCYLWRGQRLYQLSRDHSLLQRLVDERRMDIEQARAYPSARALTRAVGASEQLVLDVL
ELEVHPGDVFLLCSDGLYEELSADALGRALSLASPQVAVERLFDGALSGAARDNLTAVVI
RQ
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcaccgagccctggcgcagcgcggcgcgcacggatcgcggcaaggtccgcgcg
cgcaacgaggatgccttcctggactgcccggaccgcgggctctgggcggtcgccgatggc
atgggcgggcaccaggccggcgacctggccagccggatgatcgtcaccagcctggcggaa
ctgccggcccgggcgggattcgacgagcgcctgaacgcgatgcgccagtgcctgcactgg
ctcaaccggcgcctgggcgaggaactcaccctcagcgccgaacgcggcgacaggatcatc
ggcagtacggtggtggcgctggtcgtggagggttcgcgagcggcctgcgtgtgggtcggc
gacagccgctgctacctgtggcgcggccagcggctgtaccagctgtcccgcgaccactcg
ctgttgcagcgactggtcgacgaacggcggatggatatcgagcaggcccgcgcctatccc
tcggcgcgcgcgctgacccgtgccgtcggcgccagcgaacaactggtgctggacgtgttg
gaactggaggtgcatcccggtgatgtcttcctgctctgcagcgacgggctctacgaagag
ctgagcgccgatgcgctgggccgcgcgttgagcctggcatcgccgcaggtggcggtggag
cggctgttcgacggcgctctgagcggcgccgcgcgggacaacctgacggccgtggtgatc
cgccaatga

DBGET integrated database retrieval system