KEGG   Pseudomonas aeruginosa MTB-1: U769_28605Help
Entry
U769_28605        CDS       T02951                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
paem00010  Glycolysis / Gluconeogenesis
paem00020  Citrate cycle (TCA cycle)
paem00620  Pyruvate metabolism
paem01100  Metabolic pathways
paem01110  Biosynthesis of secondary metabolites
paem01120  Microbial metabolism in diverse environments
paem01130  Biosynthesis of antibiotics
paem01200  Carbon metabolism
Module
paem_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    U769_28605
   00020 Citrate cycle (TCA cycle)
    U769_28605
   00620 Pyruvate metabolism
    U769_28605
Enzymes [BR:paem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     U769_28605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_25 AAA_33 AAA_29
Motif
Other DBs
NCBI-ProteinID: AHB58939
Position
complement(6160114..6161655)
Genome map
AA seq 513 aa AA seqDB search
MTQANNAVYTDISAAQLVEEAIRRGEGELAANGSLVVRTGHRTGRSPVDRFIVEEPSTKD
AIAWGNINRPFPADKFDALWARVEAFNNAQDHFVSHVHVGSAEAYYLPVKMTTATAWQNL
FGRCLFIEPEQYNPAGKDEWQVLNVANFECVPERDGTNSDGCVILNFAQKKVLIAGMRYA
GEMKKAMFSVQNFLLPERDVLPMHCAANIGEAGDVTLFFGLSGTGKTTLSADESRYLIGD
DEHGWGEGVVFNVEGGCYAKCIDLSEKNEPVIWKAIKFGAVLENVVLDEERVPNYADDSL
TQNSRAAYPLEHVEKRSEKNLGGEPNAVIFLTCDLTGVLPPVSILNNEQAAYHFLSGYTA
LVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGVYAELLIKRIKAFGSKVYLVNTGWTGGGY
GVGKRFNIPTTRGVIAAIQSGALIGAETEHLDIINLDVPKVVPGVETNLLNPRNTWADKA
AYDEAAKGLAKQFIENFKKFEVSDAIKAAGPQL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagccaacaacgccgtgtacaccgatatcagcgccgcccaactggtagaagaa
gccattcgccgcggtgagggcgaactggccgccaacggctcgctggtcgtacgcaccggc
catcgcaccggccgttcgccggtcgaccgtttcatcgtcgaagagccgagcaccaaggac
gcgatcgcctggggcaacatcaaccgtccgttcccggccgacaagttcgatgcgctgtgg
gcccgcgtggaagcgttcaacaacgcccaggaccatttcgtttcccatgttcatgtaggt
tccgccgaggcttactacctgccggtgaagatgaccaccgctaccgcctggcagaatctg
ttcggccgttgcctgttcatcgagccggagcagtacaacccggccggcaaggacgagtgg
caggtcctcaatgtcgccaacttcgaatgcgtgcccgagcgcgacggcaccaactccgac
ggttgcgtgatcctcaatttcgcccagaagaaagtgctgatcgcaggcatgcgctatgcc
ggcgagatgaagaaagccatgttctccgtgcagaacttcctgctgcccgagcgcgacgtg
ctgccgatgcactgcgctgccaacatcggcgaagcgggcgatgtgaccctgttcttcggc
ctgtccggcaccggcaagaccaccctgtccgctgatgaaagccgttacctgatcggtgac
gacgagcacggctggggcgagggcgtggtgttcaacgtcgaaggcggttgctatgccaag
tgcatcgacctgtccgagaagaacgagccggtcatctggaaagccatcaagttcggcgcc
gtgctggagaacgtggttctcgacgaagagcgcgtgcccaactacgccgatgacagcctg
acccagaacagccgcgccgcctacccgctggagcacgtcgagaagcgttcggagaagaac
ctcggcggcgagcccaacgcggtgatcttcctgacctgcgacctgaccggcgtactgccg
ccggtatcgatcctgaacaatgagcaggcggcctaccacttcctgtccggctacaccgcg
ctggtcggctccaccgagatgggttccggcggcggtatcaagtcgaccttctccacctgc
ttcggtgctcctttcttcccgcgtccggccggtgtctacgccgagctgctgatcaagcgt
atcaaggccttcggctccaaggtctacctggtcaacaccggctggaccggcggtggctac
ggcgtcggcaagcgcttcaacatcccgaccacccgtggcgtgatcgcggcgatccagagc
ggcgcgctgatcggcgcggaaaccgagcacctggacatcatcaacctggacgtgccgaag
gtcgttccgggcgtcgagaccaatctgctcaacccgcgcaatacctgggccgacaaggct
gcctacgacgaggcggcgaagggcctggccaagcagttcatcgaaaacttcaagaaattc
gaggtttccgacgcgatcaaggccgccggcccgcagctgtaa

DBGET integrated database retrieval system