KEGG   Paenibacillus sp. FSL P4-0081: P40081_03870Help
Entry
P40081_03870      CDS       T03332                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
paen  Paenibacillus sp. FSL P4-0081
Brite
KEGG Orthology (KO) [BR:paen00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    P40081_03870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AIQ27431
Position
844505..845494
Genome map
AA seq 329 aa AA seqDB search
MDTSIYVLGFVIFLALAFDFINGFHDTANAIATSVSTRALKPRTAIMMAASMNFIGALMF
EGVAKKIGGSIADPALLDNGIDILIATLIAAIIWNLVTWWLGIPSSSSHALIGALAGAVY
VGAGSENVKWHGFIEIVEGLIFSPLIAFAIGYVVMMILKWIFAKRSPHTVNKGFRSMQII
TAALQSFTHGTNDAQKAMGIITFALVTSGRLDTMHVPLWVKIAAATSMALGTSIGGWKII
KTMGTKIFKIEPINGFAADISAASVIFTATLLHLPVSTTHAITSAILGVGSAKRFSAVKW
GVAGRIVVTWFITIPISAVLAGVIFKLFF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggatacatctatatatgtactaggttttgttatatttcttgcgctggcgtttgacttt
atcaatggtttccatgatacagccaacgcaatcgctacctcagtctctacacgcgcgctg
aagccgcgtacagccattatgatggcagcaagtatgaactttatcggtgcgctgatgttt
gaaggcgtagcgaagaagatcggcggcagcattgctgacccggcactcctggataacggg
atagatattcttattgcgacgctcattgcggcgattatctggaatctggtaacctggtgg
ctcgggattccatcatcgtcctcccatgcgcttatcggagctttggccggagcggtatat
gtaggtgcaggttcggagaatgtgaaatggcatggcttcattgagattgtggaggggctg
atcttctccccgctgatcgcatttgccatcggttatgttgtgatgatgattctaaagtgg
atctttgcaaagcgcagtccgcataccgtgaacaagggtttccgttccatgcagatcatt
acggcggcgctccaatccttcacacatggtacgaatgacgcccagaaggcgatggggatt
atcacctttgccctcgtaacatcgggacggctcgacactatgcatgtaccactctgggtt
aagattgcagcggcaacatccatggcgctcggaacgtccatcggcggctggaagatcatt
aagaccatgggtaccaaaattttcaaaattgagccgattaacggcttcgcagcagatatt
tcggccgcgtccgttatcttcacagctacactgcttcatctgccggtaagtacgacacat
gccattacctctgcaatcctcggggtaggctcagccaaacgcttctccgccgtgaaatgg
ggagtagccggacgtatcgtggtgacctggtttattaccattccgatcagcgcagtgctg
gcgggagtaatcttcaaactctttttctag

DBGET integrated database retrieval system