KEGG   Paenibacillus sp. FSL P4-0081: P40081_12550Help
Entry
P40081_12550      CDS       T03332                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
paen  Paenibacillus sp. FSL P4-0081
Pathway
paen00471  D-Glutamine and D-glutamate metabolism
paen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    P40081_12550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paen01011]
    P40081_12550
Enzymes [BR:paen01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     P40081_12550
Peptidoglycan biosynthesis and degradation proteins [BR:paen01011]
 Precursor biosynthesis
  Racemase
   P40081_12550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race B12-binding Flavodoxin_3
Motif
Other DBs
NCBI-ProteinID: AIQ28902
Position
2880488..2881294
Genome map
AA seq 268 aa AA seqDB search
MQQAIAILDSGVGGLTVVKEVMRQLPREKIIYFGDTARAPYGPRSTEEVKLFTEQIVDYL
IQFNPKMIVIACNTATAAALDYISAKVAIPVIGVIHPGARAAISASKNGQVGVIGTIGTI
KSGAYTAALKQLSPFVQVVSQACPALVPFVEQGLFRSEESHLAVAESLNGIKYEPIDTLI
LGCTHYPFLVEPIGKVMGPGVKLISSADETAREISTILYDKGQLARGDESPIHQFFCSGD
AEMFQRIARDWLGEQISRTPVVWQVSSM
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcaagcaatagctatattagactcaggtgtgggaggattgaccgttgtcaaggaa
gtgatgcgacagctccccagggagaaaatcatctatttcggcgatacggcgagagctccg
tacggcccccgttcgactgaggaagtgaaattgttcactgaacaaatcgtggactactta
attcaatttaatcctaaaatgattgttattgcctgcaatacggcaacagcggcagctctt
gattatatctccgccaaggtagccattcctgtgatcggagtcattcaccccggtgcccgc
gcagccatcagcgcttccaagaatggccaggtcggcgtcatcggtaccatcggtacgatc
aaaagcggtgcatatacggcggcgctgaagcagctgtcaccgttcgtgcaggtggtcagc
caggcctgcccggcgcttgtcccctttgtagaacagggattgttccgctcggaggagagt
caccttgccgtagcagagtcgctgaacggcatcaaatacgagccgattgatactctgatt
ctgggctgtacccattatccgttcctggtcgagccgatcggtaaagtaatggggccggga
gtcaagctgatcagctcggcagacgagacggcgcgggagatcagcaccattctgtatgac
aaaggccagctggcgcgcggggatgaaagcccgatccaccaattcttctgcagcggcgat
gcagagatgttccagcggatcgcccgggactggcttggcgagcagattagccgtacccct
gtagtatggcaggtatcctcgatgtag

DBGET integrated database retrieval system