KEGG   Paenibacillus sp. FSL P4-0081: P40081_25255Help
Entry
P40081_25255      CDS       T03332                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paen  Paenibacillus sp. FSL P4-0081
Pathway
paen00071  Fatty acid degradation
paen00072  Synthesis and degradation of ketone bodies
paen00280  Valine, leucine and isoleucine degradation
paen00310  Lysine degradation
paen00362  Benzoate degradation
paen00380  Tryptophan metabolism
paen00620  Pyruvate metabolism
paen00630  Glyoxylate and dicarboxylate metabolism
paen00640  Propanoate metabolism
paen00650  Butanoate metabolism
paen00900  Terpenoid backbone biosynthesis
paen01100  Metabolic pathways
paen01110  Biosynthesis of secondary metabolites
paen01120  Microbial metabolism in diverse environments
paen01130  Biosynthesis of antibiotics
paen01200  Carbon metabolism
paen01212  Fatty acid metabolism
paen02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    P40081_25255
   00630 Glyoxylate and dicarboxylate metabolism
    P40081_25255
   00640 Propanoate metabolism
    P40081_25255
   00650 Butanoate metabolism
    P40081_25255
  09103 Lipid metabolism
   00071 Fatty acid degradation
    P40081_25255
   00072 Synthesis and degradation of ketone bodies
    P40081_25255
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    P40081_25255
   00310 Lysine degradation
    P40081_25255
   00380 Tryptophan metabolism
    P40081_25255
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P40081_25255
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    P40081_25255
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    P40081_25255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paen04147]
    P40081_25255
Enzymes [BR:paen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     P40081_25255
Exosome [BR:paen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P40081_25255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIQ31111
Position
complement(5608783..5609973)
Genome map
AA seq 396 aa AA seqDB search
MNTAQEIVIVSAVRTALGTFGGSLVGIAAVDLGALVIKEALQRAGVAPEQVDEVIMGNVL
QGGLGQNPARQAAMKAGIPVEASSLTINKVCGSGMKAVHLAAQSIMAGDSEIIVAGGMEN
MSKAPYVLDQARYGYRMGNGTLIDTMVSDGLTCAFNQYHMGITAENVSEQFGISREMQDA
LAASSQEKAVRAIEAGHFKEEIVPVVIPQRKGDAIIFDTDEFPRKGTTAEKLAGLRPAFK
KDGSVTAGNASGINDGAAALVIMSAERAAALGLKPLARILSYASGGVDPSIMGMGPVPAT
KKALQRGGLTISDIDLIEANEAFAAQMLAVGQALDFPEEKVNVNGGAIALGHPIGASGAR
ILVTLVHALKQRGARTGLATLCIGGGHGVTTIIERI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagcccaagaaattgtcattgtcagtgcggtgcggacggcactcggcaccttt
ggcggaagtcttgtcggaattgccgctgtagatctgggggcgctggtcatcaaggaggcg
ctgcagcgggcgggtgttgctccggagcaggtcgatgaagtcattatgggcaatgtgctt
cagggcgggctgggccagaatccggcgcgtcaggcggcaatgaaagcgggcattccagta
gaggcctcaagcctgactatcaataaggtctgcggttcgggcatgaaggcggttcacctg
gctgcgcagagtattatggcgggagacagtgagattattgtagccggcgggatggaaaat
atgtcgaaagcgccttatgtgctggatcaggcccgttacggctaccgcatgggcaacggc
acactgatcgatacgatggtaagtgacggcctgacctgcgcgttcaaccaataccacatg
gggatcacggctgagaatgtctccgaacaattcgggatcagccgcgaaatgcaggatgcc
ctggcggcgtccagccaggagaaggccgtgcgcgccattgaagcaggccatttcaaggaa
gaaatcgtgcctgtagtcattccgcagcgaaaaggcgatgccatcatcttcgataccgat
gagtttccgcgaaagggaacaacggccgagaagctggcaggcctgcgcccggcctttaag
aaggacggcagtgtaaccgccgggaatgcctcgggcattaacgacggtgctgcggcgctg
gtcattatgtcggcggagagagctgcggcgctggggctgaagccgctggcgcgtattctg
tcctatgcgtccggaggtgttgatccttccatcatggggatggggccggttccggcaacg
aagaaggcgctgcagcggggcggcctgacgatcagcgatatcgatcttatcgaggctaac
gaggcgtttgccgcccagatgctggcagtaggccaggccctggacttcccggaggagaag
gtcaatgtgaacggcggggccatcgccctgggccatcctatcggtgcaagcggcgctaga
attctcgtaacactggtacatgcactgaagcagcgcggcgcacgcaccggtcttgccacg
ctgtgcatcggcggcgggcatggcgtcacgacaattatcgagcggatatag

DBGET integrated database retrieval system