KEGG   Paenibacillus sp. FSL P4-0081: P40081_28885Help
Entry
P40081_28885      CDS       T03332                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
paen  Paenibacillus sp. FSL P4-0081
Pathway
paen00471  D-Glutamine and D-glutamate metabolism
paen00550  Peptidoglycan biosynthesis
paen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    P40081_28885 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    P40081_28885 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paen01011]
    P40081_28885 (murD)
Enzymes [BR:paen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     P40081_28885 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:paen01011]
 Precursor biosynthesis
  Amino acid ligase
   P40081_28885 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Pyr_redox_3 Mur_ligase Pribosyltran
Motif
Other DBs
NCBI-ProteinID: AIQ31695
Position
complement(6481563..6482984)
Genome map
AA seq 473 aa AA seqDB search
MKHPDLYRGEEVVVLGLAKSGVQVAKVLHERGAVVTVNDKKERDQSPEASELESLGISVI
CGGHPEGLIHEGVALVVKNPGIPYSVAPVQQALELGIEVVTEVEVAYHLCAAPMIGITGS
NGKTTTTTWVGRMLEAAGMRPIVAGNIGTPLCQAAQEADVDNWMVVELSSFQLKGTEAFR
PKVAALLNVAETHLDYHGGMEDYVASKSKLFANQGPGDTAVLNWDDPVCRELVPYIKAAI
LPFSMTEELVQGIFVRPSFVPETEDDLKRVIIYRDYTESETEIADVDSIGLPGRFNVENA
LAACGIAIAAGADPAVLGGVLASFRGVEHRLEYVTDKAGAAYYNNSKATNSKATAMALGS
FKKPVILVAGGLDRGSDYMELLPVLGGNVKALVALGETKDKLAAVAQLAGVKTIISVDNG
ESAAAVLQEAVREASALAEAGDVVLLSPACASWDMFTSYEERGRIFKEAVHNL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatccggatttgtaccgtggtgaagaagtggtcgtcctggggctcgccaaaagc
ggcgtccaggtggccaaggtgctgcatgagcgcggcgcggttgtgacggtcaatgataaa
aaggaaagagatcaaagtcccgaagcttccgaactggaatctttgggaatttctgttata
tgcggcgggcatccggaagggctgattcatgagggtgttgcgcttgttgtaaagaatccg
gggattccctattccgtggctccggtgcagcaggctcttgagcttggcatcgaagtcgta
acggaggtagaggtggcttaccatctctgcgccgcacctatgatcggtattacgggctcc
aacgggaagacgactacaacgacctgggttggccgtatgctggaggcagcggggatgagg
cccatagttgccgggaacatcggtacgccgctctgtcaggccgctcaggaggctgacgtg
gacaactggatggttgtcgagctcagcagcttccagctcaaagggacggaagccttccgg
cccaaggtcgctgccctgttgaatgttgccgagacccatctggattatcatggggggatg
gaggattatgtggcctccaaatccaagctgttcgcgaatcaggggccgggcgacaccgct
gtactgaactgggatgatccggtctgccgcgagctggttccatatatcaaagcagccatc
ctgcccttctccatgactgaagaactggttcagggcatttttgtccgtccatcctttgtg
ccggagacagaagatgatctgaagcgggtaatcatttaccgggattatacggagagcgag
accgaaatagccgatgtggattcgatcggccttccgggccgcttcaatgtagagaatgcg
ctggccgcctgcggcatcgctattgccgcaggcgcggacccggcagtgcttggcggagtg
ctggcttccttccgcggtgtggagcaccggctggaatatgtgacagacaaggcgggggcc
gcctactataacaattccaaggctaccaattccaaagctacagccatggcgctggggtcc
ttcaagaagccggtcatcctcgttgccggaggtctggaccgcggttctgattatatggag
ctgctgcctgtcctcggagggaacgtcaaggcactggtggctcttggggagacgaaggac
aagctggccgcggttgcgcagctggcaggagtaaagacaatcatctccgtcgataatggg
gagagcgccgccgccgtgctgcaagaggccgtgcgggaggcttccgctcttgcggaagca
ggagatgtagttctcctctctcctgcctgtgccagctgggatatgtttacatcctatgag
gagcgcgggcgtatttttaaagaggcggtgcataacctttaa

DBGET integrated database retrieval system