KEGG   Pseudomonas aeruginosa PAO581: M801_2491Help
Entry
M801_2491         CDS       T03171                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paeo  Pseudomonas aeruginosa PAO581
Pathway
paeo00071  Fatty acid degradation
paeo00072  Synthesis and degradation of ketone bodies
paeo00280  Valine, leucine and isoleucine degradation
paeo00310  Lysine degradation
paeo00362  Benzoate degradation
paeo00380  Tryptophan metabolism
paeo00620  Pyruvate metabolism
paeo00630  Glyoxylate and dicarboxylate metabolism
paeo00640  Propanoate metabolism
paeo00650  Butanoate metabolism
paeo00900  Terpenoid backbone biosynthesis
paeo01100  Metabolic pathways
paeo01110  Biosynthesis of secondary metabolites
paeo01120  Microbial metabolism in diverse environments
paeo01130  Biosynthesis of antibiotics
paeo01200  Carbon metabolism
paeo01212  Fatty acid metabolism
paeo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M801_2491
   00630 Glyoxylate and dicarboxylate metabolism
    M801_2491
   00640 Propanoate metabolism
    M801_2491
   00650 Butanoate metabolism
    M801_2491
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M801_2491
   00072 Synthesis and degradation of ketone bodies
    M801_2491
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M801_2491
   00310 Lysine degradation
    M801_2491
   00380 Tryptophan metabolism
    M801_2491
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M801_2491
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M801_2491
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M801_2491
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paeo04147]
    M801_2491
Enzymes [BR:paeo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M801_2491
Exosome [BR:paeo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M801_2491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGV58093
Position
complement(2664956..2666146)
Genome map
AA seq 396 aa AA seqDB search
MTREDPIVIVSAVRTPMGGFLGDFKDVNAATLGAAAVRAAVERARLQADEVDEAVLGCVL
AAGQGQAPARQAVLGAGLARGTPCSTLNKMCGSGMKALMLAHDTLLAGSAGVALAGGMES
MSNAPYLLERARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYGFTREAQD
EFAVASLTRAQQAMRDGRFQAEIVPLTVTAGKTERLVDSDEQPPKARLDKIPTLKPAFRE
GGTVTAANSSSISDGAAALVLMRLSEAERRGLAPLAAIRGHASFADAPNLFPTAPVGAVK
RLMQRTGWSLGEVDLFEVNEAFAVVGMAAMRDLDLSHERLNVHGGACALGHPIGASGARI
VVTLLNALQQYDLERGVAAVCIGGGEATAIAVERLR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgaagatccgatcgtcatcgtcagcgccgtccgcaccccgatgggcggcttc
ctcggcgacttcaaggacgtcaacgccgctaccctcggtgccgcggcggtgcgcgccgcg
gtggagcgggcgcgcctgcaagccgacgaagtggacgaggccgtgctcggctgcgtgctc
gccgccggccagggccaggcgccggcgcgccaggcggtgcttggcgccggactggcgcgc
ggcacgccgtgctcgacgctgaacaagatgtgcggctcgggcatgaaggcgctgatgctc
gcccatgacacgttgctcgccggcagcgccggggtcgcgctggccgggggcatggaaagc
atgtccaacgcgccctacctgctggagcgcgcccgtagcggctaccgcatgggccacggc
aaggtgctcgaccacatgttcctcgacggcctcgaagacgcctacgacaagggccgcctg
atgggcaccttcgccgaggactgtgccgaggcctacggcttcacccgcgaagcacaggac
gagttcgccgtggcctcgctgacccgcgcgcagcaagccatgcgcgacgggcgcttccag
gccgagatcgtgccgctgacggtcaccgccggcaagaccgagcgcctggtggatagcgac
gagcagccgccgaaggcccggctggacaagatcccgaccctgaagccggcgttccgcgaa
ggcggcacggtgaccgcggccaactccagttcgatttccgacggcgccgccgcgctggtc
ctgatgcgcctttccgaggccgagcgacgcgggctcgcgccgttggcggcgattcgtggg
catgcttcgttcgccgacgcgccgaacctgttccccaccgcgccggtcggtgcggtgaag
cgcctgatgcagcgtaccggctggtcgctgggcgaggtcgacctgttcgaggtcaacgaa
gccttcgccgtggtcggcatggcggcaatgcgcgacctcgacctgtcccacgagcgcctc
aacgtccacggcggcgcctgtgcgctgggccatccgatcggcgcgtccggcgcgcggatc
gtcgtgaccctgctcaacgccctgcagcagtacgacctggaacgcggcgtggcggcggtc
tgcatcggcggcggcgaggcgaccgcgatcgccgtcgagcgcttgcgctga

DBGET integrated database retrieval system