KEGG   Pseudomonas aeruginosa PAO581: M801_4093Help
Entry
M801_4093         CDS       T03171                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
paeo  Pseudomonas aeruginosa PAO581
Pathway
paeo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:paeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M801_4093
Enzymes [BR:paeo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     M801_4093
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     M801_4093
    1.1.1.-  
     M801_4093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DZR
Motif
Other DBs
NCBI-ProteinID: AGV61956
Position
4359093..4360151
Genome map
AA seq 352 aa AA seqDB search
MKALRWHAARDLRLSELERQAPRPGEVELEVAYCGICGSDLHEYQSGPHSIPQAEAHPLS
GCRAPLTLGHEFCGVVAALGPGVEGPRIGDRVAVEPEYRCGECRYCREGRYNLCESMGFI
GLMGDGGFAERARVPAYMLHRLPDAVGFRQAAVLEPAAVALHALRRSSLAPGQRCAVFGL
GPIGLLLVMLARLRGIEDIAAVDVSPERLALAGEFGASRALDARDGDTAARLREGGALDC
AFEAAGSQASLDAALASLRKGGELVLVSLMGEVRLDAFDLVNRELRLLGSVGYRDAYPEL
IALLADGRLDLARAVTRSVPLEQAVEHGFEALLRDKSQLKVLVNPNPALADA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgcgctggcacgccgcccgcgacctccgcctgagcgaactggaacgccag
gcgccgcggcccggcgaagtcgaactggaagtcgcctactgcggcatctgcggcagcgac
ctgcacgaataccagagcggcccgcactcgattccccaggccgaggcgcacccgctgtcc
ggttgccgcgcgccgctgaccctcggccatgagttctgcggcgtggtcgccgcgctcggc
cctggcgtggagggaccgcgcatcggcgaccgcgtcgcggtggagccggaataccgctgc
ggcgaatgccgctactgccgggaaggccgctacaacctctgcgagtcgatgggcttcatc
ggcctgatgggcgacggcggcttcgccgagcgcgcgcgggtgccggcctacatgctgcac
cgcctgccggacgcggtgggcttccgccaggccgccgtgctcgaaccggccgccgtggcc
ctgcacgcgctgcgccgcagcagcctggcgccgggccagcgctgcgcggtgttcgggctt
ggcccgatcggtctgctgctggtgatgctcgcccgcctgcgcggaatcgaggacatcgcc
gcggtcgacgtcagtcccgagcgcctcgccctagccggcgaattcggcgccagccgggcg
ctcgacgcccgtgacggcgacacggcggcgcgcctgcgcgaaggcggcgcgctcgattgc
gccttcgaggccgccggcagccaggccagcctcgacgccgccctggccagcctgcgcaag
ggtggcgagctggtgctggtgagcctgatgggcgaggtcaggctggacgccttcgacctg
gtcaaccgcgaactgcgcctgctcggcagcgtcggctaccgcgacgcctacccggagctg
atcgccctgctcgccgatggccgcctcgacctggcccgcgcagtgacccgcagcgtgccc
ctggagcaggccgtcgagcacggtttcgaggccctgctgcgcgacaaatcgcagctcaag
gtgctggtcaatcccaacccggccctggccgacgcctga

DBGET integrated database retrieval system