KEGG   Pseudomonas aeruginosa PAO581: M801_4660Help
Entry
M801_4660         CDS       T03171                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
paeo  Pseudomonas aeruginosa PAO581
Pathway
paeo00020  Citrate cycle (TCA cycle)
paeo00620  Pyruvate metabolism
paeo01100  Metabolic pathways
paeo01110  Biosynthesis of secondary metabolites
paeo01120  Microbial metabolism in diverse environments
paeo01130  Biosynthesis of antibiotics
paeo01200  Carbon metabolism
Module
paeo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paeo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M801_4660 (mqo)
   00620 Pyruvate metabolism
    M801_4660 (mqo)
Enzymes [BR:paeo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     M801_4660 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Amino_oxidase FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGV58578
Position
4988044..4989567
Genome map
AA seq 507 aa AA seqDB search
MAQNDHETVDMLLVGAGIMSATLAVLLKELDPNLKMEVVELQESGAIESSNPWNNAGTGH
AGLCELNYTPQSADGSIDIKKAVGINTMFEVSKQFWSHLVAKGTFGSPKTFINPVPHLSF
VRGSEGIAYLKKRFESLTKHHAFETMVYSEDKATLAEWMPLMMPGRPADEAIAATRVEGG
TDVNFGALTNQLLQHLAQQPGAQIRYNQKVTHLRRADNGWRVTVKDTRNGGDREIQARFV
FLGAGGGALPLLQLSGIPEGKGFGGFPVSGQWLRCDNPEIVKQHQAKVYSQAEVGSPPMS
VPHLDTRVVDGKKSLLFGPYAGFSTKFLRHGSFLDLPLSVRPGNILPMLSVARDNMDLTR
YLIGQVMQSPEQRLEALRKFYPEARAEDWRLEVAGQRVQIIKKDPKKGGILQFGTELVAA
HDGSIAALLGASPGASVTVSIMLGLIERCFPEQARSPEWSAKLKEIFPAREKELESDAEL
YRSVSSRCSEVLELTAKNDVQAPVNAE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaacgatcacgaaacagtcgacatgctgctggtaggcgccggcatcatgagc
gcgaccctggcggtcctgctcaaggaactcgaccccaacctgaagatggaagtcgtcgaa
ctccaggagtccggcgcgatcgaaagctccaacccgtggaacaacgcgggcaccggccac
gccggcctgtgcgagctgaactacaccccgcagtcggccgacggcagcatcgacatcaag
aaagccgtgggcatcaacaccatgttcgaggtgtcgaagcagttctggtcgcacctggtc
gccaagggcaccttcggctcgccgaagaccttcatcaacccggtaccgcacctgagcttc
gtgcgcggcagcgaaggcatcgcctacctgaagaagcgcttcgaatcgctgacgaagcac
cacgctttcgagaccatggtctactccgaggacaaggccaccctcgccgagtggatgccg
ctgatgatgccgggtcgtccggccgacgaagcgatcgccgcgacccgcgtcgagggcggt
accgacgtcaacttcggcgccctgaccaaccagctcctgcaacacctggcgcaacagccg
ggcgcgcagatccgctacaaccagaaggtcacccacctgcgccgcgccgataacggctgg
cgggtcaccgtcaaggacacccgcaacggcggcgaccgcgagatccaggcacgcttcgtc
ttcctcggcgccggcggcggcgccctgccgctcctgcaactttccggcatcccggaaggc
aagggcttcggtggtttcccggtgagcggccagtggctgcgctgcgacaacccggaaatc
gtcaagcagcaccaggccaaggtctacagccaggccgaggtcggctcgccgccgatgtcc
gtgccgcacctggacacccgtgtggtggacggcaagaaatccctgctgttcggcccctat
gccggtttctccaccaagttcctgcgccatggctcgttcctcgacctgccgctgtcggta
cgcccgggcaacatcctgccgatgctctcggtggcccgcgacaacatggacctgacccgc
tacctgatcggccaggtcatgcagtcgccggaacagcgcctggaagccctgcgcaagttc
taccccgaagccagggccgaggactggcgcctggaagtcgccggccagcgcgtgcagatc
atcaagaaagatccgaagaaaggcggcatcctgcagttcggcaccgagctggtggccgcc
cacgacggctccatcgccgccctgctgggcgcctcgccgggcgcctcggtgaccgtctcg
atcatgctcggcctgatcgagcgctgcttcccggagcaggcccgctcgccggagtggagc
gccaagctgaaggaaatcttcccggctcgcgagaaagagctggaaagcgacgccgagctg
taccgcagcgtcagcagccgttgcagcgaggtgctggaactgaccgcgaagaacgacgtg
caggccccggtcaacgccgagtga

DBGET integrated database retrieval system