KEGG   Pseudomonas aeruginosa PAO581: M801_606Help
Entry
M801_606          CDS       T03171                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
paeo  Pseudomonas aeruginosa PAO581
Brite
KEGG Orthology (KO) [BR:paeo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    M801_606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AGV61816
Position
complement(650034..650414)
Genome map
AA seq 126 aa AA seqDB search
MSDTQHQVNVRVDTRYLPEQSAPEQNRFAFAYTVTIENQGEVPAQLLSRHWIITDGDGRT
QEVRGAGVVGEQPLIAPGAQHTYTSGTVLATRVGSMRGSYQMLGSDGIAFDAAIPVFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacccagcaccaggtcaacgtcagggtcgacacccgctaccttccggaacag
tccgccccggagcagaaccgtttcgccttcgcctacacggtgaccatcgagaaccagggc
gaggttccggcccaactgctgtcgcgccactggatcatcaccgacggcgacggccgtacc
caggaagttcgcggcgccggcgtggtcggcgagcaaccgctgatcgcccccggcgcgcaa
cacacctacaccagcggcacggtgctggcgacccgggtcggcagcatgcgcggcagctat
cagatgctcggcagcgacggaatcgccttcgacgccgcgatcccggtgtttcgcctggcc
gtaccgggagcgctgcactga

DBGET integrated database retrieval system