KEGG   Pseudomonas aeruginosa PA1: PA1S_12870Help
Entry
PA1S_12870        CDS       T02928                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00071  Fatty acid degradation
paep00072  Synthesis and degradation of ketone bodies
paep00280  Valine, leucine and isoleucine degradation
paep00310  Lysine degradation
paep00362  Benzoate degradation
paep00380  Tryptophan metabolism
paep00620  Pyruvate metabolism
paep00630  Glyoxylate and dicarboxylate metabolism
paep00640  Propanoate metabolism
paep00650  Butanoate metabolism
paep00900  Terpenoid backbone biosynthesis
paep01100  Metabolic pathways
paep01110  Biosynthesis of secondary metabolites
paep01120  Microbial metabolism in diverse environments
paep01130  Biosynthesis of antibiotics
paep01200  Carbon metabolism
paep01212  Fatty acid metabolism
paep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PA1S_12870
   00630 Glyoxylate and dicarboxylate metabolism
    PA1S_12870
   00640 Propanoate metabolism
    PA1S_12870
   00650 Butanoate metabolism
    PA1S_12870
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PA1S_12870
   00072 Synthesis and degradation of ketone bodies
    PA1S_12870
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA1S_12870
   00310 Lysine degradation
    PA1S_12870
   00380 Tryptophan metabolism
    PA1S_12870
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PA1S_12870
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA1S_12870
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PA1S_12870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paep04147]
    PA1S_12870
Enzymes [BR:paep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PA1S_12870
Exosome [BR:paep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA1S_12870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHA16326
Position
2698678..2699868
Genome map
AA seq 396 aa AA seqDB search
MTREDPIVIVSAVRTPMGGFLGDFKDVNAATLGAAAVRAAVERARLQADEVDEAVLGCVL
AAGQGQAPARQAVLGAGLARGTPCSTLNKMCGSGMKALMLAHDTLLAGSAGVALAGGMES
MSNAPYLLERARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYGFTREAQD
EFAVASLTRAQQAMRDGRFQAEIVPLTVTAGKTERLVDSDEQPPKARLDKIPTLKPAFRE
GGTVTAANSSSISDGAAALVLMRLSEAERRGLAPLAAIRGHASFADAPNLFPTAPVGAVK
RLMQRTGWSLGEVDLFEVNEAFAVVGMAAMRDLDLSHERLNVHGGACALGHPIGASGARI
VVTLLNALQQYDLERGVAAVCIGGGEATAIAVERLR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgaagatccgatcgtcatcgtcagcgccgtccgcaccccgatgggcggcttc
ctcggcgacttcaaggacgtcaacgccgctaccctcggcgccgcggcggtgcgcgccgcg
gtggagcgggcgcgcctgcaagccgacgaagtggacgaggccgtgctcggctgcgtgctc
gccgccggccagggccaggcgccggcgcgccaggcggtgcttggcgccgggctggcgcgc
ggcacgccgtgctcgacgctgaacaagatgtgtggctcgggcatgaaggcgctgatgctc
gcccacgacacgttgctcgccggcagcgccggggtcgcgctggccgggggcatggaaagc
atgtccaacgcgccctacctgctggagcgcgcccgtagcggctaccgcatgggccacggc
aaggtgctcgaccacatgttcctcgacggcctcgaagacgcctacgacaaaggccgcctg
atgggcaccttcgccgaggactgcgccgaggcctacggcttcacccgcgaagcacaggac
gagttcgccgtggcctcgctgacccgcgcgcagcaagccatgcgcgacgggcgcttccag
gccgagatcgtgccgctgacggtcaccgccggcaagaccgagcgcctggtggatagcgac
gagcagccgccgaaggcccggctggacaagatcccgaccctgaagccggcgttccgcgaa
ggcggcacggtgaccgcggccaactccagttcgatttccgacggcgccgccgcgctggtc
ctgatgcgcctttccgaggccgagcgacgcgggctcgcgccgttggcggcgattcgtggg
catgcttcgttcgccgacgcgccgaacctgttccccaccgcgccggtcggtgcggtgaag
cgtctgatgcagcgtaccggctggtcgctgggcgaggtcgacctgttcgaggtcaacgaa
gccttcgccgtggtcggcatggcggcaatgcgcgacctcgacctgtcccacgagcgcctc
aacgtccacggcggcgcctgtgcgctgggccatccgatcggcgcgtccggcgcgcggatc
gtcgtgaccctgctcaacgccctgcagcagtacgacctggaacgcggcgtggcggcggtc
tgcatcggcggcggcgaggcgaccgcgatcgccgtcgagcgcttgcgctga

DBGET integrated database retrieval system