KEGG   Pseudomonas aeruginosa PA1: PA1S_18205Help
Entry
PA1S_18205        CDS       T02928                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
paep  Pseudomonas aeruginosa PA1
Brite
KEGG Orthology (KO) [BR:paep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:paep03009]
    PA1S_18205
Enzymes [BR:paep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     PA1S_18205
Ribosome biogenesis [BR:paep03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PA1S_18205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AHA21050
Position
complement(3916110..3917168)
Genome map
AA seq 352 aa AA seqDB search
MNTLLMHCRPGFEGEVCAEIAEHAATLEIPGYAKSKPASAHVEFVCQDADGAERLMRRLR
FADLIFPRQWARGPGFIELPESQRIEVLLAELASYPVCGSLWLEVLDTNAGKEVSTFCRK
FEKPLRAALVKAGRLQEDPALPRLLLTFRSGREVFVGLAEPRNSALWPMGIPRLKFPREA
PSRSTLKLEEAWHQFIPRSEWDKRLAPDMLAVDLGAAPGGWTWQLVNREMRVTAVDNGPM
AENLMYSGLVDHQKVDGYQYRPRQRVDWMVCDIVEKPARTGALIETWIGEGLCREAVVNL
KLPMKQRYAEVRKILQRLRESFDARGLKVAIGCKQLYHDREEVTCHLRRLER
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaataccctgttgatgcactgccggccaggcttcgaaggtgaagtctgcgccgaaatc
gccgagcatgcagccactctcgagattcccggctacgccaagagcaagccggccagcgcc
cacgtcgagttcgtctgccaggacgccgacggcgccgagcgcctgatgcgccgcctgcgt
ttcgccgacttgatcttcccgcgccagtgggcgcgcgggcccggcttcatcgaattgccg
gaaagccagcgcatcgaggtactgctggcggaactggcgagttatccggtttgcggcagc
ctctggctggaggtgctggacaccaatgccggcaaggaggtgtcgaccttctgccgcaag
ttcgagaaaccgctgcgcgcggcgctggtgaaggccgggcggttgcaggaggacccggcg
ctgccgcgcctgctgctgaccttccgctctggccgggaagtcttcgtcggcctcgccgag
ccgcgcaacagcgcgctctggccgatgggcatcccgcgcctgaagtttccccgcgaggcg
ccgagccgttcgacgctgaagctggaggaagcctggcaccagttcatcccgcgcagcgaa
tgggacaagcgcctggcgccggacatgctcgccgtggacctcggtgcggcgccgggcggc
tggacctggcaactggttaaccgggagatgcgggtgaccgccgtggacaacgggccgatg
gcggagaacctgatgtattccgggctggtcgaccaccagaaggtcgacggctaccagtac
cgcccgcgccagcgggtcgactggatggtctgcgacatcgtcgagaagccggcacgcacc
ggtgcgttgatcgagacctggatcggcgaagggctttgccgcgaggcggtggtcaacctc
aagctgccgatgaagcagcgctacgccgaggtgcgcaagatcctccagcgcctgcgcgag
agctttgacgcgcgcggcctgaaggtagcgatcggctgcaagcagctgtatcacgaccgc
gaggaagtgacctgccatctacgccgcctcgaacgctga

DBGET integrated database retrieval system