KEGG   Pseudomonas aeruginosa PA1: PA1S_18295Help
Entry
PA1S_18295        CDS       T02928                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00860  Porphyrin and chlorophyll metabolism
paep01100  Metabolic pathways
paep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PA1S_18295
Enzymes [BR:paep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     PA1S_18295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AHA21033
Position
3936588..3937970
Genome map
AA seq 460 aa AA seqDB search
MLDTIRWDADLIRRYDLSGPRYTSYPTAVQFHEGIGPFDQLHALRDSRKGGHPLSLYVHI
PFCANICYYCACNKVITKDRGRSAPYLARLVREIEIVSRHLSREQVVEQLHFGGGTPTFL
SPGQLRELMSQLRTHLNLLDDDSGDYGIEIDPREADWSTMGLLRELGFNRVSLGVQDFDM
EVQKAVNRMQTPEETRTIVEAARTLQYRSINLDLIYGLPKQTPDSFARTVDEVIALQPDR
LSVFNYAHLPERFMPQRRINADDLPSPGQKLEMLQRTTEQLAAAGYRYIGMDHFALPDDE
LASAQEDGTLQRNFQGYTTHGHCDLVGLGVSAISQIGDLYSQNSSDINDYQTSLDNGQLA
IRRGLHCNSDDRVRRAVIQQLICHFELAFEDIETEFGIDFRSYFAELWPDLERFAADGLI
RLDAKGIDITSSGRLLVRSICMLFDRYLPSLNRQRFSRVI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccattcgctgggacgctgacctgattcggcgctacgacctttccggcccg
cgttacacctcctatccgaccgccgtgcagttccacgaaggcatcggcccgttcgaccag
ttgcacgccctgcgcgacagccggaagggcggacaccccctgtcgctctacgtgcacatc
ccgttctgcgccaacatctgctactactgcgcctgcaacaaggtgatcaccaaggatcgc
gggcgcagcgcgccgtacctcgcgcgcctggtccgcgagatcgagatcgtcagccgccac
ctctcccgcgagcaggtggtcgagcaactgcacttcggtggcggaaccccgaccttcctc
agtcccggccagttgcgcgaactcatgtcgcaattgcgcacccacctcaacctgctggac
gacgattcgggcgactacggcatcgagatcgacccacgcgaggccgactggtcgaccatg
ggcctgctccgcgaactcggtttcaaccgcgtcagcctcggcgtacaggacttcgacatg
gaggtgcagaaggcggtcaaccgcatgcagaccccggaggagacccgtaccatcgtcgag
gccgcgcgcaccctgcagtaccgctcgatcaacctcgacctgatctacggactgccgaaa
cagacgccggacagcttcgcccgcacggtcgacgaagtgatcgcgctacagccggatcgc
ctctcggtgttcaactacgcccacctgcccgagcgtttcatgccgcagcggcggatcaac
gccgacgacctgccgagcccgggccagaagctggaaatgctccagcgcaccaccgagcaa
ctcgccgcggcgggctaccgctatatcggcatggatcacttcgccctgcccgacgacgag
ctggccagcgcccaggaagacggcaccctgcaacgcaatttccagggctacaccacgcac
gggcactgtgacctggtaggtctcggggtctcggcgatcagccagatcggcgacctctac
agccagaacagcagcgacatcaacgactaccagaccagcctcgacaacggccagttggcg
atccgtcgcggcctgcactgcaacagcgacgaccgggtgcggcgcgcagtgatccagcaa
ctgatctgccacttcgaactggccttcgaggatatcgagacggagttcggcatcgacttc
cgcagctacttcgccgagctgtggcccgacctcgaacgcttcgccgccgacggcctgatc
cgcctggacgccaagggcatcgacatcacctcctccgggcgtctgctggtgcgttcgatc
tgcatgctgttcgaccgctacctgcccagcctcaaccggcagcgcttctcccgggtgatc
tga

DBGET integrated database retrieval system