KEGG   Pseudomonas aeruginosa PA1: PA1S_29245Help
Entry
PA1S_29245        CDS       T02928                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00260  Glycine, serine and threonine metabolism
paep01100  Metabolic pathways
paep01110  Biosynthesis of secondary metabolites
paep01120  Microbial metabolism in diverse environments
paep01130  Biosynthesis of antibiotics
paep01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PA1S_29245
Enzymes [BR:paep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PA1S_29245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHA19265
Position
complement(6318436..6319476)
Genome map
AA seq 346 aa AA seqDB search
MTDNTQQFASDNYSGICPEAWAAMAEANRGHERAYGDDQWTARASDYFRQLFETDCEVFF
AFNGTAANSLALAALCQSYHSVICSETAHVETDECGAPEFFSNGSKLLLAQTEVGKLTPA
SIRDIALKRQDIHYPKPRVVTLTQATEVGTVYRPDELKAISATCKELGLHLHMDGARFSN
ACAFLGCSPAELSWKAGVDVLCFGGTKNGMAVGEAILFFNRDLAEDFDYRCKQAGQLASK
MRFLAAPWVGVLQDDAWLRYADHANRCARLLAELVADVPGVSLMFPVEANGVFLQLSEPA
IEALRARGWRFYTFIGEGGARFMCSWDTDIERVRELARDIRLVMGA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataacacccaacagttcgccagcgacaactattccggtatctgccccgaagcc
tgggcggcgatggccgaagccaaccgcggccacgagcgcgcctatggcgacgaccagtgg
accgcgcgcgcttcggactacttccgccagttgttcgagaccgattgcgaagtgttcttc
gccttcaacggcaccgccgccaactccctggccttggccgcgctgtgccagagctaccac
agcgtgatctgctcggagaccgcccacgtcgagaccgacgagtgcggcgcgccggagttc
ttctccaacggctccaagctgctgctggcgcagaccgaggtcggcaagctgaccccggcg
tcgatccgcgacatcgctctcaagcgccaggatatccactatccgaagccgcgcgtggtg
actctcacccaggccaccgaggtcggcacggtgtaccgcccggacgagttgaaggcgatc
agcgccacctgcaaggaactcggcctgcacctgcacatggacggcgcgcgcttctccaac
gcctgcgccttcctcggctgctcgccggcggagctgagctggaaggccggggtcgacgtg
ctctgcttcggcggcaccaagaacggcatggcggtgggcgaggcgatcctgttcttcaac
cgcgacctggccgaggacttcgactaccgctgcaagcaggccggccaactggcctcgaag
atgcgcttcctcgccgcgccctgggtcggcgtactgcaggacgatgcctggctgcgctac
gccgatcacgccaaccgctgcgcgcgcctgctggccgagctggtggccgacgttcccggc
gtcagcctgatgttcccggtagaagccaacggcgtgttcctacagctttccgagccggcg
atcgaagccttgcgcgcgcgcggctggcgcttctacaccttcatcggtgaaggtggcgcg
cgtttcatgtgttcctgggataccgatatcgagcgggtccgcgaactggcgcgggacatc
cgcctggtgatgggcgcctga

DBGET integrated database retrieval system